DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30283 and CG31219

DIOPT Version :9

Sequence 1:NP_611587.2 Gene:CG30283 / 37454 FlyBaseID:FBgn0260477 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001097837.1 Gene:CG31219 / 42344 FlyBaseID:FBgn0051219 Length:345 Species:Drosophila melanogaster


Alignment Length:279 Identity:88/279 - (31%)
Similarity:129/279 - (46%) Gaps:57/279 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 CGTVPISQFKILGGHNAPVASAPWMAMVMG------EGGFHCGGTLITNRFVLTSAHCIANG--- 88
            ||. .:|.::::||..|.....|||||::.      |....|.|:||.||:|||||||: ||   
  Fly    80 CGQ-SLSTYRMVGGSEARPNGYPWMAMLLYLNTTTLEILPFCAGSLINNRYVLTSAHCV-NGIPR 142

  Fly    89 --ELK-VRLG----------------------VLEREAEAQKFAVDAMFVHTDYYFDQHDLALLR 128
              .|| ||||                      :...|.:.:|..|..:|........::|:||||
  Fly   143 DLSLKSVRLGEHDITYDPAYNPDCRDQDNQCALPNLEIKLEKIIVHGLFSSISNRNIEYDIALLR 207

  Fly   129 LAKRVHYSDNISPICLLLDPLVKNIDEH----IVKFRTYGWGKTESRSSSRMLQKTSLFNLHRSE 189
            |...|.|...|.|||         |.:|    ..|....|||||.....|::|....:.....:.
  Fly   208 LKMPVRYRTGIMPIC---------IPKHGFFAKSKLEIAGWGKTNEGQFSQVLMHGFIRERSIAV 263

  Fly   190 CAKQYPHQQINRN-HICAESAN-ANTCNGDSGGPLTAIVTYDHVQMVFQFGVTSFGHADCSK--- 249
            ||.::|:..:|:: .|||...: .:||.|||||||  :||.|: ..|:..|:|::|..:|.:   
  Fly   264 CALRFPYLDLNQSLQICAGGYDGVDTCQGDSGGPL--MVTMDN-SSVYLAGITTYGSKNCGQIGI 325

  Fly   250 ATVFTNVMTHLDWIVNTVR 268
            ..::|.....|.||...:|
  Fly   326 PGIYTRTSAFLPWIKAVLR 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30283NP_611587.2 Tryp_SPc 42..263 CDD:214473 82/263 (31%)
Tryp_SPc 43..266 CDD:238113 84/265 (32%)
CG31219NP_001097837.1 Tryp_SPc 88..339 CDD:214473 82/263 (31%)
Tryp_SPc 90..342 CDD:238113 84/264 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.