DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30283 and CG5246

DIOPT Version :9

Sequence 1:NP_611587.2 Gene:CG30283 / 37454 FlyBaseID:FBgn0260477 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_650603.1 Gene:CG5246 / 42072 FlyBaseID:FBgn0038484 Length:272 Species:Drosophila melanogaster


Alignment Length:278 Identity:79/278 - (28%)
Similarity:129/278 - (46%) Gaps:32/278 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKNTKIFVVVVLLAASSVVVLGSESGSFLEHPCGTVPISQFKILGGHNAPVASAPWMAMVMGEGG 65
            ||...:..|:|:|:..|...:.......|.|..|.|. .:.:::||.::|...||:...:|...|
  Fly     1 MKCLVLISVLVILSQCSAKSVKIHRRHQLNHHLGHVK-PETRVIGGVDSPTGFAPYQVSIMNTFG 64

  Fly    66 FH-CGGTLITNRFVLTSAHCIANGE-----LKVRLGVLEREAEAQKFAVDAMFVHTDY----YFD 120
            .| |||::|..:::||:|||:   |     ||:..|.::......::.||...:|..:    |  
  Fly    65 EHVCGGSIIAPQWILTAAHCM---EWPIQYLKIVTGTVDYTRPGAEYLVDGSKIHCSHDKPAY-- 124

  Fly   121 QHDLALLRLAKRVHYSDNISPICLLLDPLVKNIDEHIVKFRTYGWGKTESRSS-SRMLQKTSLFN 184
            .:|:||:..||.:.|.|...||.|.....:..:.:   |....|||.|::... |..|||..|..
  Fly   125 HNDIALIHTAKPIVYDDLTQPIKLASKGSLPKVGD---KLTLTGWGSTKTWGRYSTQLQKIDLNY 186

  Fly   185 LHRSECAKQYPHQQ-INRNHICA-ESANANTCNGDSGGPLTAIVTYDHVQMVFQFGVTSFGHADC 247
            :....|..:..:.. ::..|:|. ......:|:|||||||.     |..|.:  .||.::|.| |
  Fly   187 IDHDNCQSRVRNANWLSEGHVCTFTQEGEGSCHGDSGGPLV-----DANQTL--VGVVNWGEA-C 243

  Fly   248 S--KATVFTNVMTHLDWI 263
            :  ...||.:|..:.|||
  Fly   244 AIGYPDVFGSVAYYHDWI 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30283NP_611587.2 Tryp_SPc 42..263 CDD:214473 67/235 (29%)
Tryp_SPc 43..266 CDD:238113 69/236 (29%)
CG5246NP_650603.1 Tryp_SPc 41..261 CDD:214473 67/235 (29%)
Tryp_SPc 42..263 CDD:238113 69/236 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.