DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30283 and CG17475

DIOPT Version :9

Sequence 1:NP_611587.2 Gene:CG30283 / 37454 FlyBaseID:FBgn0260477 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001287372.1 Gene:CG17475 / 42069 FlyBaseID:FBgn0038481 Length:288 Species:Drosophila melanogaster


Alignment Length:279 Identity:80/279 - (28%)
Similarity:128/279 - (45%) Gaps:43/279 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VVVVLLAAS-----SVVVLGSESGSFLEHPCGTVPIS-QFKILGGHNAPVASAPWMAMVMG-EGG 65
            ::|:|||.:     |.|.|...|...||.......:: |.:::.|.:..:..|.:...:.| .||
  Fly     9 ILVILLACTCYKPISAVRLAQLSEDQLEWISKAEGVNFQNRVINGEDVQLGEAKYQISLQGMYGG 73

  Fly    66 FHCGGTLITNRFVLTSAHCIANGE---LKVRLGVLEREAEAQKFAVDAMFVHTDYYF-DQH-DLA 125
            ..|||.:|..|.|||:|||:....   |:|..|.:|.|.....:.|:..::|.:|.. |.| |:|
  Fly    74 HICGGCIIDERHVLTAAHCVYGYNPTYLRVITGTVEYEKPDAVYFVEEHWIHCNYNSPDYHNDIA 138

  Fly   126 LLRLAKRVHYSDNISPICLLLDPLVKNIDEHIVKFRTYGWGKTES-RSSSRMLQKTSLFNLHRSE 189
            |:||...:.:::...|..|...|:...     .:....|||.||. ..:..:|||..|.::..|.
  Fly   139 LIRLNDTIKFNEYTQPAELPTAPVANG-----TQLLLTGWGSTELWGDTPDILQKAYLTHVVYST 198

  Fly   190 CAKQYPHQQINRN-------HICA-ESANANTCNGDSGGPLTAIVTYDHVQMVFQFGVTSFGHAD 246
            |      |:|..|       |||. .:.....|:||||||||      |..::  :|:.::|: .
  Fly   199 C------QEIMNNDPSNGPCHICTLTTGGQGACHGDSGGPLT------HNGVL--YGLVNWGY-P 248

  Fly   247 CSKAT--VFTNVMTHLDWI 263
            |:...  ...||..:|:||
  Fly   249 CALGVPDSHANVYYYLEWI 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30283NP_611587.2 Tryp_SPc 42..263 CDD:214473 67/237 (28%)
Tryp_SPc 43..266 CDD:238113 69/238 (29%)
CG17475NP_001287372.1 Tryp_SPc 49..267 CDD:214473 67/237 (28%)
Tryp_SPc 50..269 CDD:238113 69/238 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.