DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30283 and CG31326

DIOPT Version :9

Sequence 1:NP_611587.2 Gene:CG30283 / 37454 FlyBaseID:FBgn0260477 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_650344.2 Gene:CG31326 / 41728 FlyBaseID:FBgn0051326 Length:520 Species:Drosophila melanogaster


Alignment Length:268 Identity:80/268 - (29%)
Similarity:122/268 - (45%) Gaps:51/268 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 PCG-----TVPISQFKILGGHNAPVASAPWMAMVM----GEG-GFHCGGTLITNRFVLTSAHC-- 84
            |||     |.|:    |..|.:......||:..:.    ..| .|.||||||:...||::|||  
  Fly   262 PCGRERASTTPL----IFQGKSLQRGQLPWLVAIFERRESNGPAFICGGTLISTSTVLSAAHCFR 322

  Fly    85 -----IANGELKVRLG--VLEREAEAQKFAVDAMFVHTDYYFDQH---DLALLRLAKRVHYSDNI 139
                 :....|.|.||  .|...::.:...|..:.:|.::.|.|.   ||||:||.:.|.|:|.|
  Fly   323 APGRDLPASRLAVSLGRNTLAIHSDGEFRGVSQLIIHENFQFKQFTEADLALVRLDEPVRYTDYI 387

  Fly   140 SPICL-----LLDPLVKNIDEHIVKFRTYGWGKTESRSSSRMLQKTSLFNL-HRSECAKQYPHQQ 198
            .||||     .:| |.:.:..::.     |||..|:.:.:..:.|.:..|: ..:.||.:.||..
  Fly   388 VPICLWSTSNRMD-LPQGLKSYVA-----GWGPDETGTGNTEVSKVTDLNIVSEANCALELPHVL 446

  Fly   199 INRNHICAESANANTCNGDSGGPLTAIVTYDHVQMVFQF-GVTSFG-------HADCSKATVFTN 255
            :..:.:||:...|..|..|.||||..     ..|.|:.. ||.|.|       ..:.||.:|||:
  Fly   447 VQPSSLCAKKTGAGPCASDGGGPLML-----REQDVWVLRGVISGGVINEKENTCELSKPSVFTD 506

  Fly   256 VMTHLDWI 263
            |..|::|:
  Fly   507 VAKHIEWV 514

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30283NP_611587.2 Tryp_SPc 42..263 CDD:214473 74/251 (29%)
Tryp_SPc 43..266 CDD:238113 75/252 (30%)
CG31326NP_650344.2 GD_N 26..126 CDD:292649
Tryp_SPc 277..517 CDD:238113 74/249 (30%)
Tryp_SPc 277..514 CDD:214473 73/247 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.