DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30283 and CG9649

DIOPT Version :9

Sequence 1:NP_611587.2 Gene:CG30283 / 37454 FlyBaseID:FBgn0260477 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_650343.1 Gene:CG9649 / 41727 FlyBaseID:FBgn0038211 Length:504 Species:Drosophila melanogaster


Alignment Length:276 Identity:79/276 - (28%)
Similarity:124/276 - (44%) Gaps:41/276 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 LGSESGSFLEHPCGTVPISQFKIL-GGHNAPVASAPWMAMVMGEGG----FHCGGTLITNRFVLT 80
            :|..||.     ||...:.|...: .|........||||.:....|    |.||||||:.|.|::
  Fly   239 IGQLSGI-----CGREKVIQTPFIHNGIEVERGQLPWMAALFEHVGRDYNFLCGGTLISARTVIS 298

  Fly    81 SAHCIANGELK-------VRLG--VLEREAEAQKFAVDAMFVHTDY----YFDQHDLALLRLAKR 132
            :|||...|...       |.||  .|:..:......|..:.:|..|    |.|. |||||:|:..
  Fly   299 AAHCFRFGSRNLPGERTIVSLGRNSLDLFSSGATLGVARLLIHEQYNPNVYTDA-DLALLQLSNH 362

  Fly   133 VHYSDNISPICLLLDPLVKNIDE-HIVKFRTYGWGKTE-SRSSSRMLQKTSLFNLHRSECAKQYP 195
            |...|.|.||||..:..:..:.. |  |....|||:.| ...::|:.:.|....:.:.||.....
  Fly   363 VDIGDYIKPICLWNENFLLELPSGH--KSYVAGWGEDEKGNRNTRLAKMTDTDIITQWECRGNLS 425

  Fly   196 HQQ---INRNHICAESANAN-TCNGDSGGPLTAIVTYDHVQMVFQFGVTSFG-----HADCSKAT 251
            .:.   |..:.|||.:|.|: .|:|||||.|  ::....:.|:  .||.|.|     ..:.:...
  Fly   426 EENAKFITSHTICASNAQASGPCSGDSGGGL--MLQEQDIWML--RGVVSAGQRMTNRCNLTLPV 486

  Fly   252 VFTNVMTHLDWIVNTV 267
            ::|:|..|::|:::::
  Fly   487 IYTDVAKHIEWLLSSM 502

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30283NP_611587.2 Tryp_SPc 42..263 CDD:214473 72/249 (29%)
Tryp_SPc 43..266 CDD:238113 73/251 (29%)
CG9649NP_650343.1 GD_N 29..124 CDD:292649
Tryp_SPc 257..498 CDD:238113 72/247 (29%)
Tryp_SPc 259..497 CDD:214473 72/244 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.