DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30283 and CG8870

DIOPT Version :9

Sequence 1:NP_611587.2 Gene:CG30283 / 37454 FlyBaseID:FBgn0260477 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_731802.1 Gene:CG8870 / 41645 FlyBaseID:FBgn0038144 Length:356 Species:Drosophila melanogaster


Alignment Length:277 Identity:82/277 - (29%)
Similarity:117/277 - (42%) Gaps:49/277 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 SFLEH-PCGTVPISQFKILGGHNAPVASAPWMAMVMGEGGFH---------CGGTLITNRFVLTS 81
            ::|.| .||.   |:.|...|....:...|||||:: .|..:         |||:||.|.:|||:
  Fly    70 TYLPHDTCGQ---SRRKPTKGKIPALNEFPWMAMLL-YGNKNNLSQKLVPKCGGSLINNWYVLTA 130

  Fly    82 AHCIANG------ELK-VRLG------------VLEREAEA---QKFAVDAMFVHTDYYFDQ--- 121
            |||:...      .|| ||||            |..|...|   .:..||.:..|..:...:   
  Fly   131 AHCVEYPFMDYPYALKTVRLGEHNTSTNPDRAIVNGRRQYAPLYMEIEVDQIITHEQFNRGRRLI 195

  Fly   122 HDLALLRLAKRVHYSDNISPICLLLDPLVKNIDEHIVKFRTYGWGKTESRSSSRMLQKTSLFNLH 186
            :|:||:||...|.|:..|.||||   |..:.:..|..||:..||.......:|.:|.::.:...|
  Fly   196 NDIALVRLKFPVRYTRAIQPICL---PRAQKLAAHKRKFQASGWPDMGQGIASEVLLRSFIAERH 257

  Fly   187 RSECAKQYPHQQINRNHICAESANAN-TCNGDSGGPLTAIVTYDHVQMVFQFGVTSFGHADC--- 247
            ...|...|....  .:.|||...:.| |..|||||||...|....|.:.:..|:.|:|...|   
  Fly   258 PDVCKSNYDFNL--GSQICAGGLDGNDTSPGDSGGPLMETVIRGKVTLTYAAGIISYGQKPCVLK 320

  Fly   248 -SKATVFTNVMTHLDWI 263
             .|...:|......:||
  Fly   321 TCKPAFYTKTSYFFEWI 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30283NP_611587.2 Tryp_SPc 42..263 CDD:214473 75/259 (29%)
Tryp_SPc 43..266 CDD:238113 76/260 (29%)
CG8870NP_731802.1 Tryp_SPc 93..340 CDD:238113 75/251 (30%)
Tryp_SPc 93..337 CDD:214473 73/249 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.