DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30283 and CG13318

DIOPT Version :9

Sequence 1:NP_611587.2 Gene:CG30283 / 37454 FlyBaseID:FBgn0260477 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_649831.1 Gene:CG13318 / 41048 FlyBaseID:FBgn0037627 Length:405 Species:Drosophila melanogaster


Alignment Length:296 Identity:75/296 - (25%)
Similarity:116/296 - (39%) Gaps:67/296 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LAASSVVVLGSESGSFLEHPCG----TVPISQFKILGGHNAPVASAPWMAMVMGEGGFHC-GGTL 72
            |..|..:|...::||:   .||    ..|.|.....|  .|...:.||.|.::.....:. ||.|
  Fly   134 LTCSYGLVACCQAGSY---QCGRRFPPPPGSTTAAPG--QASFGAYPWQAALLTTADVYLGGGAL 193

  Fly    73 ITNRFVLTSAHCIANGEL---KVRLGVLEREAEAQKFAVDAMFVHTDYY---FD----QHDLALL 127
            ||.:.|||:||.:.|..|   |||||..:..:.::......:::...|.   |:    |:|:|:|
  Fly   194 ITAQHVLTAAHKVYNLGLTYFKVRLGEWDAASTSEPIPAQDVYISNVYVNPSFNPNNLQNDVAIL 258

  Fly   128 RLAKRVHYS--DNISPICLLLDPLVKNIDEHIVKFRTYGWGKTE--------------------S 170
            :|:..|..:  ..:..:||   |....:.:   :....||||.:                    :
  Fly   259 KLSTPVSLTSKSTVGTVCL---PTTSFVGQ---RCWVAGWGKNDFGATGAYQAIERQVDVPLIPN 317

  Fly   171 RSSSRMLQKTSL---FNLHRSECAKQYPHQQINRNHICA-ESANANTCNGDSGGPLTAIVTYDHV 231
            .:....||.|.|   |.|..:             :.||| ..|..:.|.||.|.||  :.|.:.|
  Fly   318 ANCQAALQATRLGSSFVLSPT-------------SFICAGGEAGKDACTGDGGSPL--VCTSNGV 367

  Fly   232 QMVFQFGVTSFGHADCSKATVFTNVMTHLDWIVNTV 267
            ..|........|.|......|:.||.|:|.||..|:
  Fly   368 WYVVGLVAWGIGCAQAGVPGVYVNVGTYLPWIQTTL 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30283NP_611587.2 Tryp_SPc 42..263 CDD:214473 63/257 (25%)
Tryp_SPc 43..266 CDD:238113 65/259 (25%)
CG13318NP_649831.1 Tryp_SPc 169..402 CDD:238113 64/253 (25%)
Tryp_SPc 169..399 CDD:214473 62/250 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.