DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30283 and Prss45

DIOPT Version :9

Sequence 1:NP_611587.2 Gene:CG30283 / 37454 FlyBaseID:FBgn0260477 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001008864.1 Gene:Prss45 / 408244 RGDID:1303021 Length:330 Species:Rattus norvegicus


Alignment Length:267 Identity:76/267 - (28%)
Similarity:114/267 - (42%) Gaps:59/267 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 HNAPVASAPWMA-------------MVMGEGGFHCGGTLITNRFVLTSAHCI-ANGELKVRLG-- 95
            |..||..|||.:             .:..|....|||.||...:|:::|||| .|.|..|.||  
  Rat    41 HAEPVCGAPWWSDSLEERHHWPWEVSLQIENEHVCGGALIDQSWVVSAAHCIQGNKEYLVMLGSS 105

  Fly    96 VLEREAE--AQKFAVDAMFVHTDYY---FDQHDLALLRLAKRVHYSDNISPICLLLDPLVKNIDE 155
            .|:....  |.|..|..:.:|..|:   |.:.|:|||.|...|.::..|.||||         .|
  Rat   106 TLQPSGSPWALKIPVGDIIMHPKYWGQNFIRSDIALLCLETPVTFNKYIQPICL---------PE 161

  Fly   156 HI------VKFRTYGWGKTESRSSSRMLQKTSLFN-----LHRSECAKQYPHQQ---------IN 200
            |.      :|....|||:.:...|:::.:...|:.     :....|.:.: |::         |.
  Rat   162 HNFNLKVGMKCWVTGWGQAKQHPSAKLTRSLELWEAEVSIVDNKNCDRVF-HKKTFYPQVIPLIR 225

  Fly   201 RNHICAESANANTCNGDSGGPLTAIVTYDHVQMVFQFGVTSFGHADCSKA---TVFTNVMTHLDW 262
            :|.||..:...|.|.||.||||...|   |.:.:.. |:.|:..| |:||   :|:|.:..:..|
  Rat   226 KNMICTTNHRENPCYGDPGGPLACEV---HGRWILA-GIFSWEKA-CTKAPNLSVYTRIDKYTGW 285

  Fly   263 IVNTVRR 269
            |...|.|
  Rat   286 IKEQVSR 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30283NP_611587.2 Tryp_SPc 42..263 CDD:214473 72/259 (28%)
Tryp_SPc 43..266 CDD:238113 74/262 (28%)
Prss45NP_001008864.1 Tryp_SPc 57..289 CDD:238113 68/246 (28%)
Tryp_SPc 57..286 CDD:214473 66/243 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166336747
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.