DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30283 and CG7542

DIOPT Version :9

Sequence 1:NP_611587.2 Gene:CG30283 / 37454 FlyBaseID:FBgn0260477 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001287099.1 Gene:CG7542 / 39960 FlyBaseID:FBgn0036738 Length:270 Species:Drosophila melanogaster


Alignment Length:289 Identity:82/289 - (28%)
Similarity:134/289 - (46%) Gaps:53/289 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 KIFVVVVLLAASSVVVLGSESGSFLEHPCGTVPISQFKILGGHNAPVASAPWMA---MVMGEGGF 66
            |:.|.|:|:.:.:.|.|.::...:              |..|..|.|...|:.|   :..|....
  Fly     3 KLLVCVLLVGSCTAVPLLTDVEPY--------------ITNGEPAEVGQFPYQAGLNVSFGNWST 53

  Fly    67 HCGGTLITNRFVLTSAHCIANGE-LKVRLGVL----EREAEAQKFAVD--AMFVHTDYYFDQ--H 122
            .||||||::.:::|:|||:...| :.|.||.:    |.|...::..|:  .:.||::|....  :
  Fly    54 WCGGTLISHYWIITAAHCMDGAESVTVYLGAINIGDESEEGQERIMVEKSGIIVHSNYMASTVVN 118

  Fly   123 DLALLRLAKRVHYSDNISPICLLLDPLVKNIDEHIVKFRTY--------GWGKTE--SRSSSRML 177
            |::|:||...|.::|.|....|   |...|     .:|.||        |||:..  |.|.|.:|
  Fly   119 DISLIRLPAFVGFTDRIRAASL---PRRLN-----GQFPTYESIRAFASGWGRESDASDSVSPVL 175

  Fly   178 QKTSLFNLHRSECAKQYPHQQINRNHIC-AESANANTCNGDSGGPLTAIVTYDHVQMVFQFGVTS 241
            :...:..:..|.| :.|....::...|| :.::..:||:|||||||    .|......:..|.||
  Fly   176 RYVEMPIMPHSLC-RMYWSGAVSEKMICMSTTSGKSTCHGDSGGPL----VYKQGNSSYLIGSTS 235

  Fly   242 FGHA-DCSKA--TVFTNVMTHLDWIVNTV 267
            ||.: .|...  .|||.:.::||||:|.:
  Fly   236 FGTSMGCQVGFPAVFTRISSYLDWILNHI 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30283NP_611587.2 Tryp_SPc 42..263 CDD:214473 73/246 (30%)
Tryp_SPc 43..266 CDD:238113 75/248 (30%)
CG7542NP_001287099.1 Tryp_SPc 27..263 CDD:238113 75/248 (30%)
Tryp_SPc 27..260 CDD:214473 73/245 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.