DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30283 and Jon74E

DIOPT Version :9

Sequence 1:NP_611587.2 Gene:CG30283 / 37454 FlyBaseID:FBgn0260477 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster


Alignment Length:277 Identity:80/277 - (28%)
Similarity:131/277 - (47%) Gaps:34/277 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 NTKIFVVVVLLAASSVVVLGSESGSFLEHPCGTVPISQFKILGGHNAPVASAPWMAMVMGEGG-- 65
            :|.:..:::|:...|:..|.      :.|..|.      :|.||..|.....|:...:..|..  
  Fly     4 STILVFLLILVQGRSISCLD------MGHGIGG------RIAGGELARANQFPYQVGLSIEEPND 56

  Fly    66 --FHCGGTLITNRFVLTSAHCIANG-ELKVRLGVLEREAEAQ--KFAVDAMFVHTDYYFD--QHD 123
              ..||.:||::|::||:|||:... .:...||.:.|.|..|  :.....:.:|.|:...  ::|
  Fly    57 MYCWCGASLISDRYLLTAAHCVEKAVAITYYLGGVLRLAPRQLIRSTNPEVHLHPDWNCQSLEND 121

  Fly   124 LALLRLAKRVHYSDNISPICLLLDPLVKNIDEHIVKFRTYGWGK--TESRSSSRMLQKTSLFNLH 186
            :||:||.:.....|:|.||.|......:|..:::....: |||:  .||.:.|..|:....|...
  Fly   122 IALVRLPEDALLCDSIRPIRLPGLSSSRNSYDYVPAIAS-GWGRMNDESTAISDNLRYVYRFVES 185

  Fly   187 RSECAKQYPHQQINRNHICAESANA-NTCNGDSGGPLTAIVTYDHVQMV-FQFGVTSFG-HADCS 248
            ..:|  :|.:..|...:||.::... :||.|||||||   |..|.||.. ...||||:| .:.|:
  Fly   186 NEDC--EYSYANIKPTNICMDTTGGKSTCTGDSGGPL---VYSDPVQNADILIGVTSYGKKSGCT 245

  Fly   249 KA--TVFTNVMTHLDWI 263
            |.  :|||.:..:||||
  Fly   246 KGYPSVFTRITAYLDWI 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30283NP_611587.2 Tryp_SPc 42..263 CDD:214473 72/236 (31%)
Tryp_SPc 43..266 CDD:238113 74/237 (31%)
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 72/236 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.