DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30283 and CG33460

DIOPT Version :9

Sequence 1:NP_611587.2 Gene:CG30283 / 37454 FlyBaseID:FBgn0260477 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001033949.1 Gene:CG33460 / 3885588 FlyBaseID:FBgn0053460 Length:275 Species:Drosophila melanogaster


Alignment Length:281 Identity:76/281 - (27%)
Similarity:128/281 - (45%) Gaps:54/281 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VVVLLAASSVVVLGSE--SGSFLEHPCGTVPISQFKILGGHNAPVASAPWMAMVMGEGGFHCGGT 71
            :.:.|.||.::|:.|:  |.::|...||.:.......||         ||.|::..:|...|.||
  Fly     5 LTISLLASYMLVIYSDSVSANYLYEQCGLMREEFSTSLG---------PWTALLHTDGSIFCAGT 60

  Fly    72 LITNRFVLTSAHCIANGELKVRLGVLEREAEAQKFAVDAMFVHTDYYFDQH----------DLAL 126
            |||:.|:||:|.||....:|||||      |..::..:....|..:||..:          ::.|
  Fly    61 LITDVFILTAASCIRPNAVKVRLG------EFGRYPNELPEDHLVHYFLMYRLFNNESLANNIGL 119

  Fly   127 LRLAKRVHYSDNISPICLLLDPLVKNIDEHIVKFRTYGWGKTESRSSSRMLQK----------TS 181
            |:|.|||..:|.|.|:|::|:|  :|.....::|....|.:..:.|.::.|:.          |:
  Fly   120 LKLTKRVQITDYIMPVCIVLNP--QNQQLSTMRFIGNAWMEDSNVSLTKELRPIVIQSKPKMCTN 182

  Fly   182 LFNLHRSECAKQYPHQQINRNHICAESANANTCNGDSGGPLTAIVTYDHVQMVFQFGVTSFGHAD 246
            | :|:...||   .||           .|..:|:|.:|..|.....|.:.....|||:.:....|
  Fly   183 L-DLYTQFCA---GHQ-----------GNLRSCDGLTGSALIQNSRYMNKYRHIQFGIATVNDMD 232

  Fly   247 CSKATVFTNVMTHLDWIVNTV 267
            |.::..:|:|:....||.:.|
  Fly   233 CEESQGYTDVLKFYWWIQDVV 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30283NP_611587.2 Tryp_SPc 42..263 CDD:214473 64/240 (27%)
Tryp_SPc 43..266 CDD:238113 66/242 (27%)
CG33460NP_001033949.1 Tryp_SPc 44..252 CDD:304450 64/230 (28%)
Tryp_SPc 44..249 CDD:214473 62/227 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.