DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30283 and Jon65Aiv

DIOPT Version :9

Sequence 1:NP_611587.2 Gene:CG30283 / 37454 FlyBaseID:FBgn0260477 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_648012.1 Gene:Jon65Aiv / 38682 FlyBaseID:FBgn0250815 Length:271 Species:Drosophila melanogaster


Alignment Length:288 Identity:83/288 - (28%)
Similarity:134/288 - (46%) Gaps:49/288 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 FVVVVLLAASSVVVLGSESGSFLEHPCGTVPI---SQFKILGGHNAPVASAPWMA----MVMGEG 64
            |::::.||.::......|    |.|....:|:   ...:|.||.||.|...|:..    .:....
  Fly     3 FLIILALAVAASAFPEPE----LRHRSREMPVVGDIGGRITGGSNAAVGQFPYQVGLSLKLSALS 63

  Fly    65 GFHCGGTLITNRFVLTSAHCIANG--ELKVRLGVLEREAEAQKFAVDA--MFVHTDYYFD--QHD 123
            ...|||:||.:.:|||:||| .:|  .:.|.||...|.:......|.:  :.:|:.:...  ::|
  Fly    64 SAWCGGSLIGSTWVLTAAHC-TDGVQSVTVYLGATVRTSAEITHTVSSSDIIIHSGWNSANLRND 127

  Fly   124 LALLRLAKRVHYSDNISPICLLLDPLVKNIDEHIVKFRTY--------GWGKTESRSS--SRMLQ 178
            ::|::: .....|..||.:.|   |.:.|      .:.|:        |||:|...||  :..||
  Fly   128 ISLIKI-PATSSSSRISAVKL---PSISN------SYSTFVGDVAVASGWGRTSDTSSGVATNLQ 182

  Fly   179 KTSLFNLHRSECAKQYPHQQINRNHICAESANA-NTCNGDSGGPLTAIVTYDHVQMVFQFGVTSF 242
            ...|..:..::||:.|....:..:.:|..:.:| :||||||||||....:.:      |.|:|||
  Fly   183 YVDLTVITNTKCAQTYGTSVVTDSTLCVATTDAKSTCNGDSGGPLVLKSSSE------QIGLTSF 241

  Fly   243 G-HADCSKA--TVFTNVMTHLDWI-VNT 266
            | .|.|.|.  ..||.|.::|||| .||
  Fly   242 GASAGCEKGYPAAFTRVTSYLDWIKTNT 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30283NP_611587.2 Tryp_SPc 42..263 CDD:214473 72/244 (30%)
Tryp_SPc 43..266 CDD:238113 74/247 (30%)
Jon65AivNP_648012.1 Tryp_SPc 37..265 CDD:214473 72/244 (30%)
Tryp_SPc 38..268 CDD:238113 74/246 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.