DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30283 and yip7

DIOPT Version :9

Sequence 1:NP_611587.2 Gene:CG30283 / 37454 FlyBaseID:FBgn0260477 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_523944.1 Gene:yip7 / 38680 FlyBaseID:FBgn0040060 Length:270 Species:Drosophila melanogaster


Alignment Length:292 Identity:85/292 - (29%)
Similarity:129/292 - (44%) Gaps:56/292 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 KIFVVVVLLAASSVVVLGSESGSFLE-----HPCGTV--PISQFKILGGHNAPVASAPW---MAM 59
            |:|||:||       .|.|.|...|.     ||...|  |....:|..|.:|.....|:   ::.
  Fly     2 KVFVVLVL-------ALASASAGLLPNIAPVHPRDRVSTPSITGRITNGKDAVAGQFPYQVGLSF 59

  Fly    60 VMGEGGFHCGGTLITNRFVLTSAHCIANGELKVRL---GVLEREAEAQKFAVDAMFVHTDYYFD- 120
            ....|.:.|||::|.|.:|||:||| .:|...|.:   ..:....|..:....:.|...:.|.. 
  Fly    60 SSSAGSWWCGGSIIGNEWVLTAAHC-TDGAASVTIYYGATVRTSPEFTQVVSSSKFRQHESYLAL 123

  Fly   121 --QHDLALLRLAKRVHYSDNISPICLLLDPLVKNIDEHIVKFRTY--------GWGKTESRSS-- 173
              ::|::|::.:. |.:|..::.|.|   |.|.|      .:.||        |||.|..:::  
  Fly   124 TIRNDISLIQTSS-VSFSATVNKISL---PAVSN------SYSTYEGKTAVASGWGLTSDQATAV 178

  Fly   174 SRMLQKTSLFNLHRSECAKQYPHQQINRNHICAESAN-ANTCNGDSGGPLTAIVTYDHVQMVFQF 237
            ||.||...|..:..|:|.:.:....:....:|.::.| |:||.|||||||    ..|.|.:    
  Fly   179 SRDLQYVDLTIISNSKCQETFGSLIVTSRVLCVDTTNKASTCQGDSGGPL----ALDGVLI---- 235

  Fly   238 GVTSFGHAD-CSKA--TVFTNVMTHLDWIVNT 266
            |.||||.|| |...  ..||.:..:.|||..|
  Fly   236 GATSFGSADGCESGAPAAFTRITYYRDWIKET 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30283NP_611587.2 Tryp_SPc 42..263 CDD:214473 68/243 (28%)
Tryp_SPc 43..266 CDD:238113 70/245 (29%)
yip7NP_523944.1 Tryp_SPc 39..264 CDD:214473 68/243 (28%)
Tryp_SPc 40..267 CDD:238113 70/245 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.