DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30283 and CG15873

DIOPT Version :9

Sequence 1:NP_611587.2 Gene:CG30283 / 37454 FlyBaseID:FBgn0260477 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_611910.2 Gene:CG15873 / 37898 FlyBaseID:FBgn0035003 Length:297 Species:Drosophila melanogaster


Alignment Length:298 Identity:82/298 - (27%)
Similarity:131/298 - (43%) Gaps:56/298 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKNTKIFVVVVLLAASSVVVLGSESGSFLEHPCGTVPISQFKIL--GGH-------NAPVASAPW 56
            |:...:|:.::|..:.|...||         ..|.:....|::|  ||:       :..|.|...
  Fly     1 MQILTVFLGLILSTSLSDADLG---------VIGDISDETFEMLISGGYKPKSNRLSRHVVSIRT 56

  Fly    57 MAMVMGEGGFH-CGGTLITNRFVLTSAHCIAN--------GELKVRLGVLEREA---EAQKFAVD 109
            ...|...|..| |.|.|:::|.|||:|||:.:        ..::|..|.:.|.|   |:...:||
  Fly    57 KNYVRHRGDNHFCSGVLVSSRAVLTAAHCLTDRYKASMNPRGIRVVFGHITRLAVYDESDFRSVD 121

  Fly   110 AMFVHTDY-YFDQHDLALLRLAKRVHYSD-NISPICLLLDPLVKNIDEHIVKFRTYGWGKTESRS 172
            .:.||.:| .:.::|||:|||::||..|: ::.|:.:.....|...|..|    |.|||:.....
  Fly   122 RLVVHPEYERYKKNDLAILRLSERVQSSNHDVLPLLMRKTANVTYGDTCI----TLGWGQIYQHG 182

  Fly   173 S-SRMLQKTSLFNLHRSECAKQYPHQQINRNHICAESANAN-TCNGDSGGPLT---AIVTYDHVQ 232
            . |..|....:.....|.|.|.|.....:.| :|.|....: .|.||.||||.   |:       
  Fly   183 PYSNELVYLDVILRPPSLCQKHYDTFTADHN-VCTEPVGESMNCAGDMGGPLLCKGAL------- 239

  Fly   233 MVFQFGVTSFGHADCS--KATVFTNVMTHLDWIVNTVR 268
                ||:.. ||..|:  ||..|.:.:.:.|||:.|::
  Fly   240 ----FGLIG-GHMGCAGGKAMKFLSFLYYKDWILLTIQ 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30283NP_611587.2 Tryp_SPc 42..263 CDD:214473 71/250 (28%)
Tryp_SPc 43..266 CDD:238113 73/252 (29%)
CG15873NP_611910.2 Tryp_SPc 36..250 CDD:214473 65/230 (28%)
Tryp_SPc 59..250 CDD:238113 61/207 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.