DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30283 and CG12133

DIOPT Version :9

Sequence 1:NP_611587.2 Gene:CG30283 / 37454 FlyBaseID:FBgn0260477 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_610540.2 Gene:CG12133 / 36036 FlyBaseID:FBgn0033469 Length:340 Species:Drosophila melanogaster


Alignment Length:286 Identity:84/286 - (29%)
Similarity:128/286 - (44%) Gaps:57/286 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 CGTVPISQFKILGGHNAPVASAPWMAMVMGEGGFH-----------CGGTLITNRFVLTSAHCIA 86
            ||..|.|.: |:||..|.....||..::    |:.           |.|:||.:|:|||:|||:.
  Fly    53 CGQSPPSSY-IVGGMEAQSNQFPWTVLL----GYEAYTAKQRPSPMCAGSLIASRYVLTAAHCLN 112

  Fly    87 NGEL---KVRLGVLEREAE---------AQKFA-------VDAMFVHTDYYF----DQHDLALLR 128
            ..:.   :||||..:.|.:         |:.:|       ||....|..||.    ..:|:||||
  Fly   113 VNDFYVARVRLGEHDTENDPDYTWLPNGAKIWAPAHVDIDVDLRVPHEQYYTRNGRHYNDIALLR 177

  Fly   129 LAKRVHYSDNISPICL-----LLDPLVKNIDEHIVKFRTYGWGKTESRSSSRMLQKTSLFNLHRS 188
            |..||.|:..|.|||:     |.....||.     .|:..|||.:..:..|.:|::.::..:...
  Fly   178 LKSRVKYTLQIRPICIWPGIELSTSSFKNF-----PFQIAGWGDSGLQQKSTVLRQGTISGMSPD 237

  Fly   189 ECAKQYPHQQINRN-HICAES-ANANTCNGDSGGPLTAIVTYDHVQMVFQFGVTSFGHADCSKA- 250
            ||..:||...:::: .|||.. ...:|..||||.||.|.|.....|..:..|:||:|....|.. 
  Fly   238 ECLNRYPTLLVDKDIQICAMGWDGTDTGLGDSGSPLMASVGRGADQFYYLAGITSYGGGPSSYGY 302

  Fly   251 --TVFTNVMTHLDWI---VNTVRRAE 271
              .|:|...::.:||   :|.:...|
  Fly   303 GPAVYTKTSSYYEWIKKKINDIAEDE 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30283NP_611587.2 Tryp_SPc 42..263 CDD:214473 76/264 (29%)
Tryp_SPc 43..266 CDD:238113 78/269 (29%)
CG12133NP_610540.2 Tryp_SPc 62..320 CDD:238113 78/266 (29%)
Tryp_SPc 62..317 CDD:214473 76/263 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.