DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30283 and try-9

DIOPT Version :9

Sequence 1:NP_611587.2 Gene:CG30283 / 37454 FlyBaseID:FBgn0260477 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001021891.1 Gene:try-9 / 3565941 WormBaseID:WBGene00023425 Length:279 Species:Caenorhabditis elegans


Alignment Length:238 Identity:53/238 - (22%)
Similarity:95/238 - (39%) Gaps:67/238 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 GEGGF--------------HCGGTLITNRFVLTSAHCIANGE----------------------- 89
            |.|.|              |..|||::...::|:||.|...|                       
 Worm     8 GSGSFRNGGNKFSENEFVQHGTGTLVSPWHIVTAAHLIGISEDPLPDCDTGNLREAYFVRDYKNF 72

  Fly    90 ---LKVRLGV------LEREAEAQKFAVDAMFVHTDYYFDQ-------HDLALLRLAKRVHYSDN 138
               :.|...|      |.|:...:..|:.::::...|..|.       :|:|:..|.:.:.:|.:
 Worm    73 VAFVNVTCAVPEMCKGLHRKDMFKPLAIKSLYIRKGYVGDGCIDRESFNDIAVFELEEPIEFSKD 137

  Fly   139 ISPICLLLDPLVKNIDEHIVKFRTYGWGKTESRSSSRMLQKTSLFNLHR--SECAKQYPHQQINR 201
            |.|.||...|.:..|.|  ..::.:|:|:..|.|   :|:...|.:|:.  :||:..:|:..:  
 Worm   138 IFPACLPSAPKIPRIRE--TGYKLFGYGRDPSDS---VLESGKLKSLYSFVAECSDDFPYGGV-- 195

  Fly   202 NHICAESANAN-TCNGDSGGPLTAIVTYDHVQMVFQFGVTSFG 243
              .|..:.|.. :|:||||..:.......:||::  .||.|.|
 Worm   196 --YCTSAVNRGLSCDGDSGSGVVRTSDTRNVQVL--VGVLSAG 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30283NP_611587.2 Tryp_SPc 42..263 CDD:214473 53/238 (22%)
Tryp_SPc 43..266 CDD:238113 53/238 (22%)
try-9NP_001021891.1 Tryp_SPc 30..237 CDD:389826 49/216 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.