DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30283 and scaf

DIOPT Version :9

Sequence 1:NP_611587.2 Gene:CG30283 / 37454 FlyBaseID:FBgn0260477 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_610180.1 Gene:scaf / 35505 FlyBaseID:FBgn0033033 Length:655 Species:Drosophila melanogaster


Alignment Length:235 Identity:66/235 - (28%)
Similarity:106/235 - (45%) Gaps:37/235 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 NAPVASAPWMAMVMGEGG--FHCGGTLITNRFVLTSAHCIANG----ELKVR-----LGVLEREA 101
            :|..|..||.||::.|..  ..|||.:|.::|||:||.|: ||    :::|:     ||......
  Fly   428 DANFAEIPWQAMILRESSKTLICGGAIIGDQFVLSSASCV-NGLPVTDIRVKAGEWELGSTNEPL 491

  Fly   102 EAQKFAVDAMFVHTDY--YFDQHDLALLRLAKRVHYSDNISPICLL-LDPLVKNIDEHIVKFRTY 163
            ..|...|..:.||.||  ..:.||||::||.:|:.::.:|.|||:. .||  |:.::..    |.
  Fly   492 PFQLTGVKTVDVHPDYDPSTNSHDLAIIRLERRLEFASHIQPICISDEDP--KDSEQCF----TS 550

  Fly   164 GWGK--TESRSSSRMLQKTSLFNLHRSECAKQYPHQQINRNHICAESANANTCNGDSGGPLTAIV 226
            ||||  ........::..|......||||:       .:.:.:|: :...::|..|.|..| |..
  Fly   551 GWGKQALSIHEEGALMHVTDTLPQARSECS-------ADSSSVCS-ATKFDSCQFDVGSAL-ACG 606

  Fly   227 TYDHVQMVFQFGVTSFGHADCSKATVFTNVMTHLDWIVNT 266
            :...|::...|.    |...|.:..........:.|| ||
  Fly   607 SGSSVRLKGIFA----GENSCGEGQTVRFAKPDIKWI-NT 641

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30283NP_611587.2 Tryp_SPc 42..263 CDD:214473 62/230 (27%)
Tryp_SPc 43..266 CDD:238113 64/233 (27%)
scafNP_610180.1 FtsK <198..>334 CDD:332908
Tryp_SPc 428..616 CDD:238113 59/203 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.