DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30283 and Jon25Bi

DIOPT Version :9

Sequence 1:NP_611587.2 Gene:CG30283 / 37454 FlyBaseID:FBgn0260477 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001033873.1 Gene:Jon25Bi / 33708 FlyBaseID:FBgn0020906 Length:266 Species:Drosophila melanogaster


Alignment Length:286 Identity:83/286 - (29%)
Similarity:131/286 - (45%) Gaps:57/286 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 KIFVVVVL-LAASSVVVLGSESGSFLEHPCGTVPISQF--KILGGHNAPVASAPWMAMV--MGEG 64
            |:|||:.| |||.|...:..      .||......::.  :|:.|:.|....||:...:  .|.|
  Fly     2 KVFVVLALALAAVSAETVQQ------VHPKDLPKDTKINGRIVNGYPAYEGKAPYTVGLGFSGNG 60

  Fly    65 GFHCGGTLITNRFVLTSAHCIANGELKVRL--GVLEREAEAQKFAVDAMFVHT----DYYFDQ-- 121
            |:.|||::|.:.:|||:||| .||..:|.:  |...|        .:|.|.||    |:..:.  
  Fly    61 GWWCGGSIIAHDWVLTAAHC-TNGASQVTIYYGATWR--------TNAQFTHTVGSGDFIQNHNW 116

  Fly   122 -----HDLALLRLAKRVHYSDNISPICLLLDPLVKNIDEHIVKFRTY-----GWGKTESRSSSRM 176
                 :|:||:| ...|.:...::.:.|      .:.::....:..|     |||.|.:.|....
  Fly   117 PNQNGNDIALIR-TPHVDFWHMVNKVEL------PSFNDRYNMYDNYWAVACGWGLTTAGSQPDW 174

  Fly   177 LQKTSLFNLHRSECAKQYPHQQINRNHIC-AESANANTCNGDSGGPLTAIVTYDHVQMVFQFGVT 240
            ::...|..:..|||::.|..|.  ...:| :.|...:||:|||||||   |.:|..::|   |||
  Fly   175 MECVDLQIISNSECSRTYGTQP--DGILCVSTSGGKSTCSGDSGGPL---VLHDGGRLV---GVT 231

  Fly   241 SFGHADCSKATV---FTNVMTHLDWI 263
            |:...:...|.:   ||.|...||||
  Fly   232 SWVSGNGCTAGLPSGFTRVTNQLDWI 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30283NP_611587.2 Tryp_SPc 42..263 CDD:214473 70/244 (29%)
Tryp_SPc 43..266 CDD:238113 72/245 (29%)
Jon25BiNP_001033873.1 Tryp_SPc 36..257 CDD:214473 70/244 (29%)
Tryp_SPc 37..260 CDD:238113 72/245 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.