DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30283 and Jon25Bii

DIOPT Version :9

Sequence 1:NP_611587.2 Gene:CG30283 / 37454 FlyBaseID:FBgn0260477 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001285608.1 Gene:Jon25Bii / 33707 FlyBaseID:FBgn0031654 Length:276 Species:Drosophila melanogaster


Alignment Length:308 Identity:84/308 - (27%)
Similarity:124/308 - (40%) Gaps:90/308 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 KIFVVVVLLAASSV--------------VVLGSESGSFLEHPCGTVPISQFKILGGHNAPVASAP 55
            |:|:.|:.:|.:..              .||||.|||.           :.:|..|:.|.....|
  Fly     2 KLFLTVLAVAIACAAAQPEKVKPVPLKDAVLGSGSGSI-----------EGRITNGYPAYEGKVP 55

  Fly    56 W---MAMVMGEGGFHCGGTLITNRFVLTSAHCIANGELKVRL--GVLEREAEAQKFAVDAMFVHT 115
            :   :......||:.|||::|.:.:|:|:||| .:|...|.:  |.|.|        :.|.:.||
  Fly    56 YIVGLGFSSDSGGWWCGGSIIGHTWVITAAHC-THGAHSVTIYYGALWR--------LQAQYTHT 111

  Fly   116 --DYYFDQH----------DLALL--------RLAKRVHYSDNISPICLLLDPLVKNIDEHIVKF 160
              ..:|.||          |::|:        .|..:|...|.               :|....|
  Fly   112 VGSGHFRQHSDYNTNNLNNDISLINTPHVDFWHLINKVELPDG---------------NERHDSF 161

  Fly   161 RTY-----GWGK-TESRSSSRMLQKTSLFNLHRSECAKQYPHQQINRNHICAES-ANANTCNGDS 218
            ..:     |||: .:|...|..|.......:.|.||:..|....|..|.||..: ...:||.|||
  Fly   162 AGWWALASGWGRPCDSCGVSDYLNCVDSQIITRDECSSVYGTDVITDNVICTSTPGGKSTCAGDS 226

  Fly   219 GGPLTAIVTYDHVQMVFQFGVTSFGHAD-CSKATV--FTNVMTHLDWI 263
            ||||   |.:|..::|   |||||..|. |:....  ||.|.::||||
  Fly   227 GGPL---VLHDRSKLV---GVTSFVAASGCTSGLPDGFTRVTSYLDWI 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30283NP_611587.2 Tryp_SPc 42..263 CDD:214473 71/255 (28%)
Tryp_SPc 43..266 CDD:238113 73/256 (29%)
Jon25BiiNP_001285608.1 Tryp_SPc 42..268 CDD:214473 71/255 (28%)
Tryp_SPc 43..271 CDD:238113 73/256 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.