DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30283 and CG31220

DIOPT Version :9

Sequence 1:NP_611587.2 Gene:CG30283 / 37454 FlyBaseID:FBgn0260477 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_732440.2 Gene:CG31220 / 326126 FlyBaseID:FBgn0051220 Length:363 Species:Drosophila melanogaster


Alignment Length:271 Identity:84/271 - (30%)
Similarity:129/271 - (47%) Gaps:48/271 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 CGTVPISQFKILGGHNAPVASAPWMAMVM--GEGGFH--------CGGTLITNRFVLTSAHCIAN 87
            ||. |.:..:::||....:...||:||::  ....|:        |||:||..|:|||:|||:.:
  Fly    95 CGK-PQTTNRVIGGTEPNLNEYPWLAMLLYRNRSAFNPDRELVPSCGGSLINTRYVLTAAHCVTD 158

  Fly    88 GEL---KVRLG---------VLEREAEA------QKFAVDAMFVHTDY----YFDQHDLALLRLA 130
            ..|   :||||         .:.|.|..      ....|:::..|.||    |..::|:||:||.
  Fly   159 TVLQIQRVRLGEHTTSHNPDCISRGARIVCAPTHLDIDVESITSHNDYDPANYTFRNDIALVRLK 223

  Fly   131 KRVHYSDNISPICLLLDPLVKNIDEHIVKFRTY--GWGKTES-RSSSRMLQKTSLFNLHRSECAK 192
            :.|.|:....|||:|..|      ..::||:.|  |||||.. .:.|::|:..::......||::
  Fly   224 EPVRYTMAYYPICVLDYP------RSLMKFKMYVAGWGKTGMFDTGSKVLKHAAVKVRKPEECSE 282

  Fly   193 QYPHQQIN-RNHICAESA-NANTCNGDSGGPLTAIVTYDHVQMVFQFGVTSFGHADCSK---ATV 252
            :|.|:... |..|||... |..||:||||.||.......:..:.|..|:||:| ..|..   .:|
  Fly   283 KYAHRHFGPRFQICAGGLDNRGTCDGDSGSPLMGTSGRSYETITFLAGITSYG-GPCGTIGWPSV 346

  Fly   253 FTNVMTHLDWI 263
            ||.......||
  Fly   347 FTRTAKFYKWI 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30283NP_611587.2 Tryp_SPc 42..263 CDD:214473 79/260 (30%)
Tryp_SPc 43..266 CDD:238113 81/261 (31%)
CG31220NP_732440.2 Tryp_SPc 103..357 CDD:214473 79/260 (30%)
Tryp_SPc 104..360 CDD:238113 81/261 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.