DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30283 and CG8952

DIOPT Version :9

Sequence 1:NP_611587.2 Gene:CG30283 / 37454 FlyBaseID:FBgn0260477 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_573072.1 Gene:CG8952 / 32525 FlyBaseID:FBgn0030688 Length:276 Species:Drosophila melanogaster


Alignment Length:254 Identity:70/254 - (27%)
Similarity:127/254 - (50%) Gaps:27/254 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 NTKIFVVVVLLAASSVVVLGSESGSFLEHPCGTVPIS-QFKILGGHNAPVASAPWMAMVMGEG-- 64
            |::..:::|||||.|||      |...: |..:.||. ..:|:.|.:|.:...||..::..:.  
  Fly     4 NSERSLMLVLLAAISVV------GQPFD-PANSSPIKIDNRIVSGSDAKLGQFPWQVILKRDAWD 61

  Fly    65 GFHCGGTLITNRFVLTSAHCIANG--ELKVRLGVLER-EAEAQKFAVDAMFVHTDYYFDQ--HDL 124
            ...|||::|::.:|||:||| .||  .:.:..|.::. .|.|.....:.:.:|.||. |:  :|:
  Fly    62 DLLCGGSIISDTWVLTAAHC-TNGLSSIFLMFGTVDLFNANALNMTSNNIIIHPDYN-DKLNNDV 124

  Fly   125 ALLRLAKRVHYSDNISPICLLLDPLVKNID--EHIVKFRTYGWGKTESRSSSRMLQKTSLFNLHR 187
            :|::|.:.:.:|.||..| .|:.....:||  ..:.....:|:.:.|....|..|....:..:..
  Fly   125 SLIQLPEPLTFSANIQAI-QLVGQYGDSIDYVGSVATIAGFGYTEDEYLDYSETLLYAQVEIIDN 188

  Fly   188 SECAKQYPHQQINRNHICA---ESANANTCNGDSGGPLTAIVTYDH-VQMVFQFGVTSF 242
            ::|...|....:..:.:||   :.::.:||.|||||||   :.|:. :|...|.|:.||
  Fly   189 ADCVAIYGKYVVVDSTMCAKGFDGSDMSTCTGDSGGPL---ILYNKTIQQWQQIGINSF 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30283NP_611587.2 Tryp_SPc 42..263 CDD:214473 57/214 (27%)
Tryp_SPc 43..266 CDD:238113 57/213 (27%)
CG8952NP_573072.1 Tryp_SPc 37..268 CDD:214473 57/214 (27%)
Tryp_SPc 38..271 CDD:238113 57/213 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.