DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30283 and CG14780

DIOPT Version :9

Sequence 1:NP_611587.2 Gene:CG30283 / 37454 FlyBaseID:FBgn0260477 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_569920.2 Gene:CG14780 / 31102 FlyBaseID:FBgn0025383 Length:302 Species:Drosophila melanogaster


Alignment Length:227 Identity:65/227 - (28%)
Similarity:91/227 - (40%) Gaps:46/227 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 GFHCGGTLITNRFVLTSAHCIANGELK---------VRLGVLEREAEAQKFAVDAM----FVHT- 115
            |..|||.||..|.|||:|||:.|.:.|         |.||.|.|........|..:    ::|| 
  Fly    62 GHICGGALIAPRKVLTAAHCLYNNQRKRFRRASEFVVVLGTLNRFEHRNGTIVSQVSSMAYMHTF 126

  Fly   116 --DYYFDQHDLALLRL------AKRVHYSDNISPICLL--LDPLVKNIDEHIVKFRTYGWGKTES 170
              |...|...:..||.      ...||.:  ::||.|.  :.|..|       ..:..|||:||.
  Fly   127 SPDSMRDDVGILFLRTGLPMSPGGGVHLT--VAPIQLAGQITPPGK-------LCQVAGWGRTEQ 182

  Fly   171 RSSSRMLQKTSLFNLHRSECAKQYPHQQINRNHICAESANANT--CNGDSGGPLTAIVTYDHVQM 233
            .|.|.:|...::..:....|...| ...:....:||......|  |.|||||||.      |...
  Fly   183 SSLSNILLTANVSTIRHQTCRMIY-RSGLLPGMMCAGRLQGGTDSCQGDSGGPLV------HEGR 240

  Fly   234 VFQFGVTSFGH--ADCSKATVFTNVMTHLDWI 263
            :  .||.|:|:  |:.....|:.:|..:..||
  Fly   241 L--VGVVSWGYGCAEPGLPGVYVDVEYYRQWI 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30283NP_611587.2 Tryp_SPc 42..263 CDD:214473 63/225 (28%)
Tryp_SPc 43..266 CDD:238113 65/227 (29%)
CG14780NP_569920.2 Tryp_SPc 32..270 CDD:214473 63/225 (28%)
Tryp_SPc 33..271 CDD:238113 65/227 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442143
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.