DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30283 and HABP2

DIOPT Version :9

Sequence 1:NP_611587.2 Gene:CG30283 / 37454 FlyBaseID:FBgn0260477 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_004123.1 Gene:HABP2 / 3026 HGNCID:4798 Length:560 Species:Homo sapiens


Alignment Length:278 Identity:86/278 - (30%)
Similarity:124/278 - (44%) Gaps:65/278 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 CGTVPISQFK---ILGGHNAPVASAPWMAMV---------MGEGGFHCGGTLITNRFVLTSAHC- 84
            ||...|::.|   |.||..:.....||.|.:         |.:|.| |||.||...:|||:||| 
Human   301 CGKTEIAERKIKRIYGGFKSTAGKHPWQASLQSSLPLTISMPQGHF-CGGALIHPCWVLTAAHCT 364

  Fly    85 -IANGELKVRLG---VLEREAEAQKFAVDAMFVHTDY----YFDQHDLALLRLAKRVHYSDNISP 141
             |....|||.||   :.:.|...|.|.|:.:|.::.|    ....:|:|||:|          .|
Human   365 DIKTRHLKVVLGDQDLKKEEFHEQSFRVEKIFKYSHYNERDEIPHNDIALLKL----------KP 419

  Fly   142 I---CLLLDPLVKNI-----------DEHIVKFRTYGWGKTESRSSSRMLQKTSLFNLHRSEC-A 191
            :   |.|....||.:           :.||     .|||.||:...||.|....:..:..:.| :
Human   420 VDGHCALESKYVKTVCLPDGSFPSGSECHI-----SGWGVTETGKGSRQLLDAKVKLIANTLCNS 479

  Fly   192 KQYPHQQINRNHICA---ESANANTCNGDSGGPLTAIV--TYDHVQMVFQFGVTSFGHADCSKAT 251
            :|.....|:.:.|||   :....:||.||||||||...  ||      :.:|:.|:| .:|.|..
Human   480 RQLYDHMIDDSMICAGNLQKPGQDTCQGDSGGPLTCEKDGTY------YVYGIVSWG-LECGKRP 537

  Fly   252 -VFTNVMTHLDWIVNTVR 268
             |:|.|...|:||..|::
Human   538 GVYTQVTKFLNWIKATIK 555

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30283NP_611587.2 Tryp_SPc 42..263 CDD:214473 80/262 (31%)
Tryp_SPc 43..266 CDD:238113 81/261 (31%)
HABP2NP_004123.1 EGF 77..106 CDD:306513
KR 191..277 CDD:238056
Tryp_SPc 314..553 CDD:238113 81/261 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143045
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.