DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30283 and GZMK

DIOPT Version :9

Sequence 1:NP_611587.2 Gene:CG30283 / 37454 FlyBaseID:FBgn0260477 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_002095.1 Gene:GZMK / 3003 HGNCID:4711 Length:264 Species:Homo sapiens


Alignment Length:269 Identity:73/269 - (27%)
Similarity:116/269 - (43%) Gaps:60/269 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 GSFLEHPCGTVPISQFKILGGHNAPVASAPWMAMVMGEGGFH-CGGTLITNRFVLTSAHC---IA 86
            |:::.|.|     ...:|:||......|.|:||.:. .||.| |||.||..::|||:|||   ..
Human    15 GAYMTHVC-----FNMEIIGGKEVSPHSRPFMASIQ-YGGHHVCGGVLIDPQWVLTAAHCQYRFT 73

  Fly    87 NGEL-KVRLG---VLEREAEAQKFAVDAMFVHTDYYFD--QHDLALLRLAKRVHYSDNISPICLL 145
            .|:. .|.||   :.:.||..|...:......:....|  .:|:.|::|......:.::..:   
Human    74 KGQSPTVVLGAHSLSKNEASKQTLEIKKFIPFSRVTSDPQSNDIMLVKLQTAAKLNKHVKML--- 135

  Fly   146 LDPLVKNIDEHI---------VKFRTYGWGKT--ESRSSSRMLQKTSLFNLHRSECAKQYPHQQ- 198
                      ||         .|.:..|||.|  :|...|..|::.::..|.|..|..|..:.. 
Human   136 ----------HIRSKTSLRSGTKCKVTGWGATDPDSLRPSDTLREVTVTVLSRKLCNSQSYYNGD 190

  Fly   199 --INRNHICAESANA--NTCNGDSGGPLTAIVTYDHVQMVFQFGVTSFGHADCSKAT---VFTNV 256
              |.::.:||..|..  ::|.|||||||..       :.||. .:.|.|| :|..||   ::| :
Human   191 PFITKDMVCAGDAKGQKDSCKGDSGGPLIC-------KGVFH-AIVSGGH-ECGVATKPGIYT-L 245

  Fly   257 MT--HLDWI 263
            :|  :..||
Human   246 LTKKYQTWI 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30283NP_611587.2 Tryp_SPc 42..263 CDD:214473 68/251 (27%)
Tryp_SPc 43..266 CDD:238113 70/252 (28%)
GZMKNP_002095.1 Tryp_SPc 26..254 CDD:214473 68/251 (27%)
Tryp_SPc 27..257 CDD:238113 70/252 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143014
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.