DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30283 and Habp2

DIOPT Version :9

Sequence 1:NP_611587.2 Gene:CG30283 / 37454 FlyBaseID:FBgn0260477 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001001505.2 Gene:Habp2 / 292126 RGDID:1302979 Length:558 Species:Rattus norvegicus


Alignment Length:285 Identity:88/285 - (30%)
Similarity:133/285 - (46%) Gaps:49/285 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 LGSESGSFLEHP----CGTVPISQF---KILGGHNAPVASAPWMAMV---------MGEGGFHCG 69
            |||.....:|.|    ||...:::.   :|.||..:.....||...:         |.:|.| ||
  Rat   283 LGSLQEPVMELPGFDSCGKTEMTEHAVKRIYGGFKSTAGKHPWQVSLQTSLPLTTSMPQGHF-CG 346

  Fly    70 GTLITNRFVLTSAHC--IANGELKVRLG---VLEREAEAQKFAVDAMFVHTDY----YFDQHDLA 125
            |:||...:|||:|||  ::...|||.||   :.:.|:..|.|.|:.:..::.|    ....:|:|
  Rat   347 GSLIHPCWVLTAAHCTDMSTKHLKVVLGDQDLKKTESHEQTFRVEKILKYSQYNERDEIPHNDIA 411

  Fly   126 LLRLAKRV--H---YSDNISPICLLLDPLVKNIDEHIVKFRTYGWGKTESRSSSRMLQKTSLFNL 185
            ||:| |.|  |   .|..:..:||..||.....:.||     .|||.||:...||.|....:..:
  Rat   412 LLKL-KPVGGHCALESKYVKTVCLPSDPFPSGTECHI-----SGWGVTETGEGSRQLLDAKVKLI 470

  Fly   186 HRSEC-AKQYPHQQINRNHICA---ESANANTCNGDSGGPLTAIV--TYDHVQMVFQFGVTSFGH 244
            ..:.| ::|.....|:.:.|||   :...::||.||||||||...  ||      :.:|:.|:|.
  Rat   471 ANALCNSRQLYDHTIDDSMICAGNLQKPGSDTCQGDSGGPLTCEKDGTY------YVYGIVSWGQ 529

  Fly   245 ADCSKATVFTNVMTHLDWIVNTVRR 269
            ....|..|:|.|...|:||..|:.:
  Rat   530 ECGKKPGVYTQVTKFLNWIKTTMHK 554

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30283NP_611587.2 Tryp_SPc 42..263 CDD:214473 78/249 (31%)
Tryp_SPc 43..266 CDD:238113 80/251 (32%)
Habp2NP_001001505.2 EGF_CA 71..107 CDD:238011
KR 191..275 CDD:238056
Tryp_SPc 312..551 CDD:238113 80/251 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166336756
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.