DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30283 and Gzmk

DIOPT Version :9

Sequence 1:NP_611587.2 Gene:CG30283 / 37454 FlyBaseID:FBgn0260477 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_058815.1 Gene:Gzmk / 29165 RGDID:68401 Length:258 Species:Rattus norvegicus


Alignment Length:192 Identity:58/192 - (30%)
Similarity:91/192 - (47%) Gaps:15/192 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 KILGGHNAPVASAPWMAMVMGEGGFHCGGTLITNRFVLTSAHCIANGEL-KVRLG---VLEREAE 102
            :|:||......|.|:||.:...|...|||.||..::|||:|||.:.|.. .|.||   :.:.|..
  Rat    25 EIIGGREVQPHSRPFMASIQYRGKHICGGVLIHPQWVLTAAHCYSRGHSPTVVLGAHSLSKNEPM 89

  Fly   103 AQKFAVDAMFVHTDYYFDQHDLALLRLAKRVHYSDNISPICLLLDPLVKNIDEHIVKFRTYGWGK 167
            .|.|.:......:.:....:|:.|::|......:.::.    ||....||......|.:..|||.
  Rat    90 KQTFEIKEFIPFSGFKSGTNDIMLIKLRTAAELNKHVQ----LLHLRSKNYIRDGTKCQVTGWGS 150

  Fly   168 T--ESRSSSRMLQKTSLFNLHRSECAKQ--YPHQQ-INRNHICA--ESANANTCNGDSGGPL 222
            |  :..::|..||:.::..:.|..|..|  |.|:. |.::.|||  .....::|.|||||||
  Rat   151 TKPDVLTTSDTLQEVTVTIISRKRCNSQSYYNHKPVITKDMICAGDRRGEKDSCKGDSGGPL 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30283NP_611587.2 Tryp_SPc 42..263 CDD:214473 58/192 (30%)
Tryp_SPc 43..266 CDD:238113 58/191 (30%)
GzmkNP_058815.1 Tryp_SPc 25..248 CDD:214473 58/192 (30%)
Tryp_SPc 26..251 CDD:238113 58/191 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166336725
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.