DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30283 and CG18636

DIOPT Version :9

Sequence 1:NP_611587.2 Gene:CG30283 / 37454 FlyBaseID:FBgn0260477 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster


Alignment Length:278 Identity:106/278 - (38%)
Similarity:153/278 - (55%) Gaps:21/278 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 FVVVVLLAASSVVVLGSESGSFLEHPCG--TVPISQFKILGGHNAPVASAPWMAMVMGEGG-FHC 68
            ||.::|:    ..:|.|....||:..||  |...:.::|:.||.|...|:|||..:..... |.|
  Fly    11 FVGIILM----FQLLHSGCSQFLDPACGIRTQSRTAYRIINGHTAKYNSSPWMVFLHSTTDMFVC 71

  Fly    69 GGTLITNRFVLTSAHC-IANGELKVRLGVLEREAE----------AQKFAVDAMFVHTDYYFDQH 122
            ||:|||::.|||:||| |||..|..|||..||...          .::..|||.|.|..|..:.|
  Fly    72 GGSLITDKLVLTAAHCFIANQHLVARLGEYERTRSEECTGYYCNFREEHMVDAGFKHKLYDPNTH 136

  Fly   123 --DLALLRLAKRVHYSDNISPICLLLDPLVKNIDEHIVKFRTYGWGKTESRSSSRMLQKTSLFNL 185
              |:|:|||:|.|.|.|||.|||::.|...::..:.|......|||||:..|.|..||...:...
  Fly   137 ANDIAILRLSKSVVYRDNIRPICVVWDHRWRHYLDKIDLLTATGWGKTQMESDSDALQTLDIRRQ 201

  Fly   186 HRSECAKQYPHQQINRNHICAESANANTCNGDSGGPLTAIVTYDHVQMVFQFGVTSFGHADCSKA 250
            ....||| :..|.|..|..||.:.::|.|||||||||.|::|:.:.|...|.|:.|:.:.:|.||
  Fly   202 PPDVCAK-FIGQTIAGNQFCAGNWDSNLCNGDSGGPLGAVITHKNTQRFVQVGIASYTNRNCQKA 265

  Fly   251 TVFTNVMTHLDWIVNTVR 268
            :|||:|::|.::|:...|
  Fly   266 SVFTDVLSHAEFILRVWR 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30283NP_611587.2 Tryp_SPc 42..263 CDD:214473 94/234 (40%)
Tryp_SPc 43..266 CDD:238113 95/236 (40%)
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 94/234 (40%)
Tryp_SPc 45..278 CDD:238113 94/233 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
76.950

Return to query results.
Submit another query.