DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30283 and CG33458

DIOPT Version :9

Sequence 1:NP_611587.2 Gene:CG30283 / 37454 FlyBaseID:FBgn0260477 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_995854.2 Gene:CG33458 / 2768846 FlyBaseID:FBgn0053458 Length:281 Species:Drosophila melanogaster


Alignment Length:285 Identity:94/285 - (32%)
Similarity:151/285 - (52%) Gaps:37/285 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VVVVLLAASSVVVLG---SESGSF-LEHPCGTVPISQ--FKILGGHNAPVASAPWMAMVMGEGGF 66
            ::..|||   :::||   |...|: ||..||   ||:  ::|.||.::|:...||:|.:.....|
  Fly     3 LIPALLA---LLILGHGISLGYSYLLEWDCG---ISKYTYRITGGRDSPLMLNPWLAYLHINSKF 61

  Fly    67 HCGGTLITNRFVLTSAHCI--ANGELKVRLGVLEREAEAQ-------------KFAVDAMFVH-- 114
            .|||:|:.:.||||:|||.  .|.::.||||  |.:|..:             ::.:....:|  
  Fly    62 ICGGSLLNHWFVLTAAHCFRDKNAKVLVRLG--ENDASQKIDCNESECAAPHLEYMIMQKLIHPL 124

  Fly   115 --TDYYFDQHDLALLRLAKRVHYSDNISPICLLLDPLVKNIDEHIVKFRTYGWGKTESRSSSRML 177
              |.:|:   |:||.:|.:.|.|:|:|.||||:|:|..:...:.|..|...|||.|.:...|..|
  Fly   125 YRTAHYY---DIALAKLNRYVVYTDSIRPICLMLNPNWQVYVDTIRYFIITGWGATNASEVSDKL 186

  Fly   178 QKTSLFNLHRSECAKQYPHQQINRNHICAESANANTCNGDSGGPLTAIVTYDHVQMVFQFGVTSF 242
            |.|.:..:.|..|...:.: .::|.||||..:......|||||||.::|.|.:.:..||||:.|.
  Fly   187 QLTRIPQIDRFTCRYWFGY-MVDRTHICAGESKHYVGKGDSGGPLGSMVDYKYAKRFFQFGIVSH 250

  Fly   243 GHADCSKATVFTNVMTHLDWIVNTV 267
            ........:||||::::.:||..|:
  Fly   251 LRQPFHGVSVFTNILSYSNWIHRTI 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30283NP_611587.2 Tryp_SPc 42..263 CDD:214473 78/239 (33%)
Tryp_SPc 43..266 CDD:238113 80/241 (33%)
CG33458NP_995854.2 Tryp_SPc 37..271 CDD:214473 78/239 (33%)
Tryp_SPc 38..274 CDD:238113 80/241 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.800

Return to query results.
Submit another query.