DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30283 and Gzma

DIOPT Version :9

Sequence 1:NP_611587.2 Gene:CG30283 / 37454 FlyBaseID:FBgn0260477 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_703198.1 Gene:Gzma / 266708 RGDID:628640 Length:261 Species:Rattus norvegicus


Alignment Length:253 Identity:76/253 - (30%)
Similarity:121/253 - (47%) Gaps:44/253 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 KILGGHNAPVASAPWMAMVMGEGGFHCGGTLITNRFVLTSAHCIANGELKVRLGV--LEREAEAQ 104
            :|:||......|.|:|.::..:....|.|.||...:|||:||||...:.:|.||.  :::|.|.|
  Rat    28 RIIGGDTVVPHSRPYMVLLKLKPDSICAGALIAKNWVLTAAHCIPGKKSEVILGAHSIKKEPEQQ 92

  Fly   105 KFAVDAMFVHTDYYFDQH----DLALLRLAKRVHYSDNISPICLLLDPLVKNIDE-------HIV 158
            ..:|...:.:.  .||:|    ||.||||.|:...:.|::.:     .|.|..|:       |:.
  Rat    93 ILSVKKAYPYP--CFDKHTHEGDLQLLRLKKKATLNKNVAIL-----HLPKKGDDVKPGTRCHVA 150

  Fly   159 KFRTYGWGKTESRS-SSRMLQKTSLFNLHRSEC--AKQYP-HQQINRNHICAES--ANANTCNGD 217
                 |||:..::| .|..|::.::..:.|..|  .|.|. :..|..|.|||.:  ...::|.||
  Rat   151 -----GWGRFHNKSPPSDTLREVNITVIDRKICNDEKHYNFNPVIGLNMICAGNLRGGKDSCYGD 210

  Fly   218 SGGPLTAIVTYDHVQMVFQFGVTSFG----HADCSKATVFTNVM-THLDWIVNTVRRA 270
            |||||..       :.:|: |:|:||    ..|.....::|.:. .|||||..|.:.|
  Rat   211 SGGPLLC-------EGIFR-GITAFGLEGRCGDPKGPGIYTLLSDKHLDWIRKTAKGA 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30283NP_611587.2 Tryp_SPc 42..263 CDD:214473 72/244 (30%)
Tryp_SPc 43..266 CDD:238113 74/246 (30%)
GzmaNP_703198.1 Tryp_SPc 28..253 CDD:214473 72/244 (30%)
Tryp_SPc 29..256 CDD:238113 74/246 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166336765
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.