DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30283 and Prss45

DIOPT Version :9

Sequence 1:NP_611587.2 Gene:CG30283 / 37454 FlyBaseID:FBgn0260477 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_694812.1 Gene:Prss45 / 260408 MGIID:3605764 Length:317 Species:Mus musculus


Alignment Length:271 Identity:74/271 - (27%)
Similarity:112/271 - (41%) Gaps:50/271 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 SFLEHPCGTVPISQFKILGGHNAPVASAPWMAMVMGEGGFHCGGTLITNRFVLTSAHCI-ANGEL 90
            ::.|..||| |.....:...|:     .||.|.:..|....|||.||...:|:::|||| .|.|.
Mouse    40 NYTEPVCGT-PWWPDNLEESHH-----WPWEASLQIEDKHVCGGALIDRSWVVSAAHCIQGNKEY 98

  Fly    91 KVRLGVLEREAEAQ----KFAVDAMFVHTDYY---FDQHDLALLRLAKRVHYSDNISPICLLLDP 148
            .|.||.........    |..|..:.:|..|:   |.:.|:|||.|...|.::..:.||||    
Mouse    99 SVMLGSSTLHPNGSSWTLKIPVGDIIIHPKYWGRNFIRSDIALLCLETPVTFNKYVQPICL---- 159

  Fly   149 LVKNIDEHIVKFR------TYGWGKTESRSSSRM-----LQKTSLFNLHRSEC------AKQYPH 196
                 .||...|:      ..|||:.:..||:::     |.:..:|.:....|      ...||.
Mouse   160 -----PEHNFNFKVGTKCWVTGWGQVKQHSSAQLTPAPELWEAEVFIIDNKNCDSIFHKKTLYPQ 219

  Fly   197 --QQINRNHICAESANANTCNGDSGGPLTAIVTYDHVQMVFQFGVTSFGHADCS---KATVFTNV 256
              ..|.:|.||..:...:.|.||.||||...:....:..    ||.|:..| |:   ..:|:|.:
Mouse   220 VVPLIRKNMICTTNYGEDLCYGDPGGPLACEIDGRWILA----GVFSWEKA-CATVPNLSVYTRI 279

  Fly   257 MTHLDWIVNTV 267
            ..:..||.:.|
Mouse   280 TKYTIWIKDQV 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30283NP_611587.2 Tryp_SPc 42..263 CDD:214473 66/250 (26%)
Tryp_SPc 43..266 CDD:238113 68/252 (27%)
Prss45NP_694812.1 Tryp_SPc 59..289 CDD:238113 68/248 (27%)
Tryp_SPc 59..286 CDD:214473 66/245 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833184
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.