DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30283 and CG30323

DIOPT Version :9

Sequence 1:NP_611587.2 Gene:CG30283 / 37454 FlyBaseID:FBgn0260477 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_725729.2 Gene:CG30323 / 246539 FlyBaseID:FBgn0050323 Length:306 Species:Drosophila melanogaster


Alignment Length:258 Identity:52/258 - (20%)
Similarity:91/258 - (35%) Gaps:76/258 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 GEGGFHCGGTLITNRFVLTSAHCIA----------NGELKVRLGV-----LEREAEAQKFAVDAM 111
            |:..| |.|:|::..:|:||..|::          :....:|:.|     |::.:....:.|..:
  Fly    49 GDNHF-CAGSLLSAWWVVTSGCCVSTRPESTPNQPSNRKNLRVVVFTPKRLKKPSPKNIYHVQKI 112

  Fly   112 FVHTDYYFDQHDLALLRLAK----------------------------RVHYSD--NISPICLLL 146
            .:.........:||||:|.:                            |::|..  .||.:|   
  Fly   113 VLDESAISGCTELALLKLDRGVTGQRFAMMLPEKELNSTWLCNSLGWGRIYYVSYVYISAMC--- 174

  Fly   147 DPLVKNI-DEHIVKFRTYGWGKTESRSSSRMLQKTSLFNLHRSECAKQYPHQQINRNHICAES-- 208
             |....: |..:..|:.   |...|.......||.|.:.. :.:|::          .:|..|  
  Fly   175 -PAFSMVYDNPVTWFQD---GPYSSELIQIRAQKISEYEC-KPDCSR----------CLCMTSYT 224

  Fly   209 ANANTCNGDSGGPLTAIVTYDHVQMVFQFGVTSFGH-ADCSKATVFTNVMTHLDWIVNTVRRA 270
            ...|.|..|.|.||..    ||    |.:||....| .|......:||:..:..:|.:|:..|
  Fly   225 GRGNMCQQDLGSPLFC----DH----FLYGVARRVHTCDDEGFMFYTNIYQNRKFIEDTLSGA 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30283NP_611587.2 Tryp_SPc 42..263 CDD:214473 49/249 (20%)
Tryp_SPc 43..266 CDD:238113 50/252 (20%)
CG30323NP_725729.2 Tryp_SPc 45..275 CDD:304450 50/252 (20%)
Tryp_SPc 45..272 CDD:214473 49/249 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.