DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30283 and CG30087

DIOPT Version :9

Sequence 1:NP_611587.2 Gene:CG30283 / 37454 FlyBaseID:FBgn0260477 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_725489.2 Gene:CG30087 / 246446 FlyBaseID:FBgn0050087 Length:277 Species:Drosophila melanogaster


Alignment Length:282 Identity:88/282 - (31%)
Similarity:145/282 - (51%) Gaps:28/282 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 FVVVVLLAASSVVVLGSESGSFLEHPCGTVPISQ--FKILGGHNAPVASAPWMAMVMGEGGFHCG 69
            ||:.:.|.....:|    ...||...||....||  .:::.|..|.:.|||:|..|......|||
  Fly     8 FVIAICLIRQQRIV----DAQFLNPLCGVTYESQTAMRVVNGKEAVIRSAPFMVYVTNNSLTHCG 68

  Fly    70 GTLITNRFVLTSAHCIANGELKVRLGV--LEREAEAQ---------KFAVDAMFVHTDYYFDQH- 122
            |:::.:|::||:|||:. ..|::|||.  :..:.:.|         ::.:.....|..|....| 
  Fly    69 GSILNSRYILTAAHCVF-PNLRLRLGEHNIRTDPDCQGSNCSPRSEEYGIMKAITHRFYNAANHV 132

  Fly   123 -DLALLRLAKRVHYSDNISPICLLLDPLVKNIDEHIVKFRTYGWGKTESRSSSRMLQKTSLFNLH 186
             |:|||:|.:.::::.:|.|||:||:|...   ..:..::|:|||:|:......:||...|....
  Fly   133 NDIALLKLNRSINFNVHIQPICILLNPASA---PSVATYQTFGWGETKKNGFPHLLQTAELRAYD 194

  Fly   187 RSECAKQYPHQQINRNHICAESANANTCNGDSGGPLTAIVTYDHVQMVFQFGVTSFGHADCSKAT 251
            .:.|::.: |..:|.|.|||.....:||.|||||||...|.:|.|:...|.|:.|:|..||....
  Fly   195 AAYCSRSF-HAYMNGNQICAGHEERDTCAGDSGGPLVTRVDFDGVKRYLQLGIVSYGPTDCQSPG 258

  Fly   252 VFTNVMTHLDWIVNTVRRAEIM 273
            |:|.|..:::||    |||.::
  Fly   259 VYTYVPNYINWI----RRAMLI 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30283NP_611587.2 Tryp_SPc 42..263 CDD:214473 73/233 (31%)
Tryp_SPc 43..266 CDD:238113 75/235 (32%)
CG30087NP_725489.2 Tryp_SPc 41..270 CDD:214473 73/233 (31%)
Tryp_SPc 42..272 CDD:238113 75/238 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25741
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
77.060

Return to query results.
Submit another query.