DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30283 and CG30082

DIOPT Version :9

Sequence 1:NP_611587.2 Gene:CG30283 / 37454 FlyBaseID:FBgn0260477 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001188942.1 Gene:CG30082 / 246443 FlyBaseID:FBgn0050082 Length:280 Species:Drosophila melanogaster


Alignment Length:264 Identity:85/264 - (32%)
Similarity:135/264 - (51%) Gaps:33/264 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 FLEHPCGT---VPISQFKILGGHNAPVASAPWMAMVMGEGGFHCGGTLITNRFVLTSAHCIANGE 89
            |::..|||   :|.:. :|:||..|.:.|.||:|.:.......|.|||||.|||||:|||:.:..
  Fly    23 FIDPNCGTTINLPPTN-RIVGGRTADIGSNPWLAYLHKNSSLVCTGTLITKRFVLTAAHCLHSFH 86

  Fly    90 -LKVRLGVLEREAEA-----------QKFAVDAMFVHTDYYF-----DQHDLALLRLAKRVHYSD 137
             |.||||..:.....           ::::|:..::||  :|     .::|:.||:|...|.|..
  Fly    87 LLTVRLGEYDTSTRIDCTSEFCIPTYEEYSVENAYIHT--FFGGRQDSRNDIGLLKLNGTVVYKL 149

  Fly   138 NISPICLLLDPLVKNIDEHIVKFRTY---GWGKTESRSSSRMLQKTSLFNLHRSECAKQYPHQQI 199
            .|.||||..||      ..:....||   ||||.:..:::.:||..:|..|.:|:|.:.. ...:
  Fly   150 FIRPICLFRDP------GQVPYSSTYEAAGWGKIDLINTATVLQTVNLIRLDQSDCERSL-RTSL 207

  Fly   200 NRNHICAESANANTCNGDSGGPLTAIVTYDHVQMVFQFGVTSFGHADCSKATVFTNVMTHLDWIV 264
            :....||....|:||:|||||||:..::...:....|.|:.|:||..|....|:|.|.:..:||:
  Fly   208 SYGQFCAGQWRADTCSGDSGGPLSRKMSNGRITRTVQLGIVSYGHYLCRGPGVYTYVPSFTNWIL 272

  Fly   265 NTVR 268
            :..|
  Fly   273 SITR 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30283NP_611587.2 Tryp_SPc 42..263 CDD:214473 77/240 (32%)
Tryp_SPc 43..266 CDD:238113 79/242 (33%)
CG30082NP_001188942.1 Tryp_SPc 39..271 CDD:214473 77/240 (32%)
Tryp_SPc 40..274 CDD:238113 79/242 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.