DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30283 and CG30002

DIOPT Version :9

Sequence 1:NP_611587.2 Gene:CG30283 / 37454 FlyBaseID:FBgn0260477 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001163100.1 Gene:CG30002 / 246384 FlyBaseID:FBgn0260474 Length:311 Species:Drosophila melanogaster


Alignment Length:274 Identity:83/274 - (30%)
Similarity:129/274 - (47%) Gaps:53/274 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 EHPCGT----VPI--SQFKILGGHNAPVASAPWMAMVMGEGGFH---------CGGTLITNRFVL 79
            :..||.    :|.  .:|.|.||..:.:.|.||||.:      |         |||:||:..|||
  Fly    43 QQDCGVRSNQIPAVRIRFMITGGRKSSLMSQPWMAFL------HIASDLEMCRCGGSLISELFVL 101

  Fly    80 TSAHCI----ANGELKVRLGVLEREAEA---------------QKFAVDAMFVHTDY--YFDQHD 123
            |:|||.    .:.|::|.||.|:..:.:               ::|.:|...:|.::  ::..:|
  Fly   102 TAAHCFKMCPRSKEIRVWLGELDLSSTSDCTTYNYERVCAPPVEEFTIDKWILHEEFNLFYPGYD 166

  Fly   124 LALLRLAKRVHYSDNISPICL-LLDPLVKNIDEHIVKFRTYGWGKTESRSSSRMLQKTSLFNLHR 187
            :||::|.|:|.:.|:|.|||| |.|.|:....:...:|...||||||   |.|....|...::..
  Fly   167 IALIKLNKKVVFKDHIRPICLPLTDELLAFTLQLGQRFMAVGWGKTE---SLRYANSTMEVDIRT 228

  Fly   188 SECAKQYPHQQINRNHICAESANANTCNGDSGGPLTAIVTYDHVQMVFQFGVTSFGHADCSKA-- 250
            .:|.     ...:.:.:||.....:||||||||||....|........||||.|.|..:|...  
  Fly   229 EKCT-----DGRDTSFLCASGDYVDTCNGDSGGPLLWKTTLFGKDRAVQFGVVSTGSQNCGAGHK 288

  Fly   251 TVFTNVMTHLDWIV 264
            ..:.:|.|::.||:
  Fly   289 AYYMDVPTYMPWIL 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30283NP_611587.2 Tryp_SPc 42..263 CDD:214473 77/253 (30%)
Tryp_SPc 43..266 CDD:238113 79/255 (31%)
CG30002NP_001163100.1 Tryp_SPc 62..301 CDD:214473 77/252 (31%)
Tryp_SPc 62..301 CDD:238113 77/252 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.