DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30283 and Mst1

DIOPT Version :9

Sequence 1:NP_611587.2 Gene:CG30283 / 37454 FlyBaseID:FBgn0260477 Length:273 Species:Drosophila melanogaster
Sequence 2:XP_038936729.1 Gene:Mst1 / 24566 RGDID:3114 Length:747 Species:Rattus norvegicus


Alignment Length:271 Identity:74/271 - (27%)
Similarity:123/271 - (45%) Gaps:49/271 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 SFLEHP-------CG--TVPISQFKILGGHNAPVASAPWMAMVMGEGGFH-CGGTLITNRFVLTS 81
            |.|:.|       ||  ....::.:::|||   ..::||...:....|.| |||:|:..::|||:
  Rat   495 SILDPPVQVQFEKCGKRVDQSNRLRVVGGH---PGNSPWTVSLRNRQGQHFCGGSLVKEQWVLTA 556

  Fly    82 AHCIANGE-----LKVRLGVLER-----EAEAQKFAVDAMFVHTDYYFDQHDLALLRLAKRVHYS 136
            ..||.:..     .:|.||.:.:     ||..|:.:|    ..|........|.||:|.:.|..:
  Rat   557 RQCIWSCHDPLTGYEVWLGTINQNPQPGEANLQRVSV----AKTVCGPAGSQLVLLKLERPVILN 617

  Fly   137 DNISPICLLLDPLVKNIDEHIVKFRT----YGWGKTESRSSSRMLQKTSLFNLHRSECAKQYPHQ 197
            .:::.||  |.|     ::::|...|    .|||:::..|:|.:|....:..:...||..:| .:
  Rat   618 HHVARIC--LPP-----EQYVVPPGTNCEIAGWGESKGTSNSTVLHVAKMKVISSQECNVKY-RR 674

  Fly   198 QINRNHICAESANANT--CNGDSGGPLTAIVTYDHVQMVFQFGVTSFGHADCSK---ATVFTNVM 257
            ::..:.||.|...|.|  |.||.||||..   |.|...|.| |:. ..:..|::   ..:||.|.
  Rat   675 RVQESEICTEGLLAPTGACEGDYGGPLAC---YTHDCWVLQ-GLI-IPNRVCARPRWPAIFTRVS 734

  Fly   258 THLDWIVNTVR 268
            ..:|||...|:
  Rat   735 VFVDWINKVVQ 745

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30283NP_611587.2 Tryp_SPc 42..263 CDD:214473 66/240 (28%)
Tryp_SPc 43..266 CDD:238113 68/242 (28%)
Mst1XP_038936729.1 PAN_1 32..111 CDD:394981
KR 116..196 CDD:214527
KR 199..276 CDD:214527
KR 321..403 CDD:214527
KR 408..490 CDD:214527
Tryp_SPc 520..743 CDD:238113 68/242 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166336736
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.