DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30283 and try-5

DIOPT Version :9

Sequence 1:NP_611587.2 Gene:CG30283 / 37454 FlyBaseID:FBgn0260477 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_505421.3 Gene:try-5 / 187088 WormBaseID:WBGene00006623 Length:327 Species:Caenorhabditis elegans


Alignment Length:336 Identity:80/336 - (23%)
Similarity:131/336 - (38%) Gaps:87/336 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VVVLLAASSVVVLGSESGSFLEHPCG-TVPISQFKI---LGGHNAPVASAPWMAMV---MGEGGF 66
            ::|.|....||:.|::...:.:..|| ....:.|.:   .|....|...|||...:   ..:|.|
 Worm     5 IIVFLFQVLVVIKGTKLKYYNDELCGRQSTYTSFMLTDAAGNTGNPTHLAPWAVQIRVKARKGDF 69

  Fly    67 H--CGGTLITNRFVLTSAHCI--------ANGE-------------------------------- 89
            .  |||||||.:.|||:|||.        ..||                                
 Worm    70 EVICGGTLITLKHVLTAAHCFQKHFGAKKEGGEENSMSGRYCESNQRFTDSEILTRTVVTVGAMC 134

  Fly    90 --LKVRLGVLEREAEAQKFAVDAMFVHTDYYFDQ----HDLALLRLAKRVHYSDNISPICLLLDP 148
              |:.:.|.:..:...:...: :.|...|:|...    :|:.:|.|...:...:..:..||...|
 Worm   135 TRLEQKYGCVNEKQNGKTLKI-SRFAIGDFYKTHCEQGNDIVILELESTIDDVEGANYACLPFLP 198

  Fly   149 LVKNIDEHIVKFRTYGW----GKTESRSSSRMLQKTSLFNLHRSECAKQYPHQQINRNHIC-AES 208
            .| ||... ....::||    ||....::..|:|..:|.....:.|.:.: ...|..:..| ||.
 Worm   199 EV-NIQSG-ANVTSFGWGSDPGKGFDNAAFPMIQVLTLATETLATCEENW-GTSIPFDSFCTAEE 260

  Fly   209 ANANTCNGDSGGPLT------------AIVTY--DHVQMVFQFGVTSFGHADCSKATVFTNVMTH 259
            .:.|.|:|||||.||            |||:|  |.||::        |.:: .::.:.|:|..|
 Worm   261 EDKNVCSGDSGGGLTFHQSDSAREFIIAIVSYGSDCVQLI--------GGSE-PRSQINTDVRKH 316

  Fly   260 LDWIVNTVRRA 270
            ..:|||.:.:|
 Worm   317 QKFIVNFINQA 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30283NP_611587.2 Tryp_SPc 42..263 CDD:214473 68/293 (23%)
Tryp_SPc 43..266 CDD:238113 70/295 (24%)
try-5NP_505421.3 Tryp_SPc 48..296 CDD:389826 60/251 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.