DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30283 and try-4

DIOPT Version :9

Sequence 1:NP_611587.2 Gene:CG30283 / 37454 FlyBaseID:FBgn0260477 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_508030.4 Gene:try-4 / 185148 WormBaseID:WBGene00006622 Length:324 Species:Caenorhabditis elegans


Alignment Length:304 Identity:73/304 - (24%)
Similarity:108/304 - (35%) Gaps:95/304 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 LEHPCGTVPISQFKILGGHNAPVASAPWMAMVMGEGGFHCGGTLITNRFVLTSAH---------- 83
            |...||....|:.|          :.||......:|....||::|:...::|:||          
 Worm    43 LMESCGIQQESKIK----------NFPWAVSFTVDGVNRLGGSIISPYHIITAAHGFITTIGSRG 97

  Fly    84 --CIANGELKVRLGVLEREAEAQKFAVDAMFV---------HTDYY------------------- 118
              | .|...|.....:.|..   ||..|...|         |||.|                   
 Worm    98 NLC-ENKNWKKPNSSIYRSI---KFLRDTRKVAYGGTCIRGHTDKYPNDPRCKKSDVIHNKVRAV 158

  Fly   119 -----------FDQHDLALLRLAKRVHYSDNISPICLLLDPLVKNIDEHIVKFRTYGWGKTESRS 172
                       ...||.|::.:.||:|:|:|:.||||....:.     :.......|||::...:
 Worm   159 LVDGEFASSNCLKGHDWAIVEVEKRIHFSENVRPICLPRPNMY-----YTKSLAVPGWGRSYIFN 218

  Fly   173 SSRMLQKTSLFNLHRSECAKQYPHQQINR------NHICAESANAN------TCNGDSGGPLTAI 225
            .|..|.......:.| :|.:.:.    :|      :.|||.|.|.:      ||:|||||.|   
 Worm   219 ESGPLIHEIPMRIDR-DCKRPWS----DRLPADADDFICATSMNVSNYSAPRTCHGDSGGGL--- 275

  Fly   226 VTY--DHVQMVFQFGVTSFGHADCSKATV--FTNVMTHLDWIVN 265
             .|  |:....|...:||||...|....:  ||.|..:|:.|.|
 Worm   276 -EYRDDNYGRAFLIAITSFGTRGCPSNMLARFTRVDMYLNLICN 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30283NP_611587.2 Tryp_SPc 42..263 CDD:214473 67/287 (23%)
Tryp_SPc 43..266 CDD:238113 68/290 (23%)
try-4NP_508030.4 Tryp_SPc 51..318 CDD:238113 69/294 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.