DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30283 and Mst1

DIOPT Version :9

Sequence 1:NP_611587.2 Gene:CG30283 / 37454 FlyBaseID:FBgn0260477 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_032269.3 Gene:Mst1 / 15235 MGIID:96080 Length:716 Species:Mus musculus


Alignment Length:274 Identity:73/274 - (26%)
Similarity:119/274 - (43%) Gaps:50/274 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 SFLEHP-------CG--TVPISQFKILGGHNAPVASAPWMAMVMGEGGFH-CGGTLITNRFVLTS 81
            |.|:.|       ||  ....::.:::|||   ..::||...:....|.| |||:|:..::|||:
Mouse   464 SILDPPDQVVFEKCGKRVDKSNKLRVVGGH---PGNSPWTVSLRNRQGQHFCGGSLVKEQWVLTA 525

  Fly    82 AHCIANGE-----LKVRLGVLER-----EAEAQKFAVDAMFVHTDYYFDQHDLALLRLAKRVHYS 136
            ..||.:..     .:|.||.:.:     ||..|:..|.......    ....|.||:|.:.|..:
Mouse   526 RQCIWSCHEPLTGYEVWLGTINQNPQPGEANLQRVPVAKAVCGP----AGSQLVLLKLERPVILN 586

  Fly   137 DNISPICLLLDPLVKNIDEHIV----KFRTYGWGKTESRSSSRMLQKTSLFNLHRSECAKQYPHQ 197
            .:::.||  |.|     ::::|    |....|||::...|::.:|...|:..:...||..:| ..
Mouse   587 HHVALIC--LPP-----EQYVVPPGTKCEIAGWGESIGTSNNTVLHVASMNVISNQECNTKY-RG 643

  Fly   198 QINRNHICAES--ANANTCNGDSGGPLTAIVTYDHVQMVFQFGVTSFGHADCSK---ATVFTNVM 257
            .|..:.||.:.  .....|.||.||||..   |.|...|.| |:. ..:..|::   ..:||.|.
Mouse   644 HIQESEICTQGLVVPVGACEGDYGGPLAC---YTHDCWVLQ-GLI-IPNRVCARPRWPAIFTRVS 703

  Fly   258 THLDWIVNTVRRAE 271
            ..:||| |.|.:.|
Mouse   704 VFVDWI-NKVMQLE 716

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30283NP_611587.2 Tryp_SPc 42..263 CDD:214473 63/240 (26%)
Tryp_SPc 43..266 CDD:238113 65/242 (27%)
Mst1NP_032269.3 PAN_1 25..96 CDD:278453
KR 108..188 CDD:214527
KR 191..269 CDD:214527
KR 291..372 CDD:214527
KR 377..459 CDD:214527
Tryp_SPc 488..709 CDD:214473 63/240 (26%)
Tryp_SPc 489..712 CDD:238113 66/243 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833173
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.