DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30283 and Gzmk

DIOPT Version :9

Sequence 1:NP_611587.2 Gene:CG30283 / 37454 FlyBaseID:FBgn0260477 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_032222.1 Gene:Gzmk / 14945 MGIID:1298232 Length:263 Species:Mus musculus


Alignment Length:226 Identity:63/226 - (27%)
Similarity:99/226 - (43%) Gaps:31/226 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 SSVVVLGSESGSFLEHPCGTVPISQFKILGGHNAPVASAPWMAMVMGEGGFHCGGTLITNRFVLT 80
            ||..::...:|.::...|     ...:|:||......|.|:||.:.......|||.||..::|||
Mouse     4 SSWALVSLVAGVYMSSEC-----FHTEIIGGREVQPHSRPFMASIQYRSKHICGGVLIHPQWVLT 63

  Fly    81 SAHCIA----NGELKVRLGV--------LEREAEAQKFAVDAMFVHTDYYFDQHDLALLRLAKRV 133
            :|||.:    .....|.||.        :::..|.:||   ..|.........||:.|::|....
Mouse    64 AAHCYSWFPRGHSPTVVLGAHSLSKNEPMKQTFEIKKF---IPFSRLQSGSASHDIMLIKLRTAA 125

  Fly   134 HYSDNISPICLLLDPLVKNIDEHIVKFRTYGWG--KTESRSSSRMLQKTSLFNLHRSECAKQ--Y 194
            ..:.|:.    ||....||......|.:..|||  |.:..::|..|::.::..:.|..|..|  |
Mouse   126 ELNKNVQ----LLHLGSKNYLRDGTKCQVTGWGTTKPDLLTASDTLREVTVTIISRKRCNSQSYY 186

  Fly   195 PHQQ-INRNHICAESANA--NTCNGDSGGPL 222
            .|:. |.::.|||..|..  ::|.|||||||
Mouse   187 NHKPVITKDMICAGDARGQKDSCKGDSGGPL 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30283NP_611587.2 Tryp_SPc 42..263 CDD:214473 59/200 (30%)
Tryp_SPc 43..266 CDD:238113 59/199 (30%)
GzmkNP_032222.1 Tryp_SPc 25..253 CDD:214473 59/200 (30%)
Tryp_SPc 26..256 CDD:238113 59/199 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833162
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.