DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30283 and CG43742

DIOPT Version :9

Sequence 1:NP_611587.2 Gene:CG30283 / 37454 FlyBaseID:FBgn0260477 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001261130.1 Gene:CG43742 / 14462622 FlyBaseID:FBgn0263999 Length:474 Species:Drosophila melanogaster


Alignment Length:278 Identity:92/278 - (33%)
Similarity:144/278 - (51%) Gaps:40/278 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 VLLAASSVVVLGSESGSFLEHPCGTVPISQFKILGGHNAPVASAPWMAMVMGEGGFHCGGTLITN 75
            :||.|  ||:..:.....|:..| .|.|: :::..||.|  .::.:||.:.....|.|||:||..
  Fly     7 LLLVA--VVIYQNAFAQLLDENC-KVKIT-YRVANGHTA--ITSQFMAALYNNSEFFCGGSLIHK 65

  Fly    76 RFVLTSAHCIAN-GELKVRLG-------------VLEREAEAQKFAVDAMFVHTDYYFD--QHDL 124
            ::|||:|||:.: .|:.|.||             ||...|:        :.:|.:::.:  .:|:
  Fly    66 QYVLTAAHCVRDLDEVTVHLGENNRSCPIPVCKHVLRLNAK--------VILHPNFHGNIFLNDI 122

  Fly   125 ALLRLAKRVHYSDNISPICLLLDPLVKNIDEHIVKFRTYGWGKTESRSSSRMLQKTSLFNLHRSE 189
            |||||.:.|.:..:|.|||::||..|.:.:::  .|..|||||||..:.|.:|....|..|.:|.
  Fly   123 ALLRLEREVIFEAHIRPICIILDEDVTSNNQN--NFTAYGWGKTEHGNISDVLSFIDLVRLPKSM 185

  Fly   190 CAKQYPHQQINRNHICAESANANTCNGDSGGPLTAIVTYDHVQMVFQFGVTSFGHADCSKA-TVF 253
            |     :|.||.  |||.|.:.:||..||||||.....:........||:||:|.|:||.. .|:
  Fly   186 C-----YQNINT--ICAGSTSGDTCESDSGGPLIGNFVHRGKSRDILFGITSYGDAECSGLFGVY 243

  Fly   254 TNVMTHLDWIVNTVRRAE 271
            |:|..:..||.:.|..:|
  Fly   244 TDVNAYKSWIASVVLESE 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30283NP_611587.2 Tryp_SPc 42..263 CDD:214473 79/237 (33%)
Tryp_SPc 43..266 CDD:238113 81/239 (34%)
CG43742NP_001261130.1 Tryp_SPc 34..253 CDD:214473 79/237 (33%)
Tryp_SPc 35..256 CDD:238113 81/239 (34%)
Tryp_SPc 273..467 CDD:214473
Tryp_SPc 273..>368 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
55.050

Return to query results.
Submit another query.