DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30283 and CG43336

DIOPT Version :9

Sequence 1:NP_611587.2 Gene:CG30283 / 37454 FlyBaseID:FBgn0260477 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001247122.1 Gene:CG43336 / 12798414 FlyBaseID:FBgn0263041 Length:279 Species:Drosophila melanogaster


Alignment Length:277 Identity:104/277 - (37%)
Similarity:151/277 - (54%) Gaps:27/277 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VVVVLLAASSVVVLGSESGSFLEHPCG------TVPISQFKILGGHNAPVASAPWMAMVMG-EGG 65
            ||||.|....:.:|||.  .||:..||      :||    ::..|..|.:.|:||||.:.. :|.
  Fly     3 VVVVGLTFFLLPLLGST--QFLDMACGIRAHSPSVP----RVKNGTVASLTSSPWMAFLHSTDGR 61

  Fly    66 FHCGGTLITNRFVLTSAHC-IANGELKVRLGVLEREAEAQ------KFAVDAM----FVHTDY-- 117
            |.|||:|||||.|||:||| :...||..|||..:||....      .:.::||    |.|..|  
  Fly    62 FICGGSLITNRLVLTAAHCFLDRTELVARLGEYDREEYEMCHDSYCTYRIEAMVERGFRHRHYNP 126

  Fly   118 YFDQHDLALLRLAKRVHYSDNISPICLLLDPLVKNIDEHIVKFRTYGWGKTESRSSSRMLQKTSL 182
            ....:|:|:|||.::|.|:|||.|||:::||..:...:.:......|||||||...|..|:...|
  Fly   127 MTMAYDIAILRLYRKVQYTDNIRPICIVIDPRWRKYIDSLDPLTGTGWGKTESEGDSAKLRTVDL 191

  Fly   183 FNLHRSECAKQYPHQQINRNHICAESANANTCNGDSGGPLTAIVTYDHVQMVFQFGVTSFGHADC 247
            ...|...| ::|....:..|..||.:..:|.||||||||:.|::.|...:...|.|:.||.:..|
  Fly   192 ARKHPEVC-RRYATLSLTANQFCAGNERSNLCNGDSGGPVGALIPYGKSKRFVQVGIASFTNTQC 255

  Fly   248 SKATVFTNVMTHLDWIV 264
            ...:|||:||:::|||:
  Fly   256 VMVSVFTDVMSYVDWIL 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30283NP_611587.2 Tryp_SPc 42..263 CDD:214473 88/234 (38%)
Tryp_SPc 43..266 CDD:238113 90/236 (38%)
CG43336NP_001247122.1 Tryp_SPc 37..271 CDD:214473 88/234 (38%)
Tryp_SPc 40..271 CDD:238113 88/231 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25741
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
87.960

Return to query results.
Submit another query.