DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30283 and CG43124

DIOPT Version :9

Sequence 1:NP_611587.2 Gene:CG30283 / 37454 FlyBaseID:FBgn0260477 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001247345.1 Gene:CG43124 / 12798282 FlyBaseID:FBgn0262587 Length:245 Species:Drosophila melanogaster


Alignment Length:290 Identity:62/290 - (21%)
Similarity:108/290 - (37%) Gaps:93/290 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 NTKIFVVVVLLAASSVVVLGSESGSFLEHPCGTVPISQFKILGGHNAPVASAPWMAMVMGEGGFH 67
            ||..::|:.:     |::....|...||..|    :...:.:.|.    :.|||:|.::.:....
  Fly     2 NTARWIVLCI-----VLMFYQGSAQTLEEDC----VDHMERINGS----SYAPWLAEILSDSKVI 53

  Fly    68 CGGTLITNRFVLTSAHCI-ANGELKVRLGVLEREAEAQKFAVDAMFVHTDYYF--------DQHD 123
            |.|.||.|.:|||:|.|. .|.:|.||||....:...:.|.|      |..||        :.::
  Fly    54 CAGALINNLYVLTAASCFKENEKLTVRLGSGYFDKSYENFRV------TKAYFWMTHFPANNTNN 112

  Fly   124 LALLRLAKRVHYSDNISPICLLLDP--------------------LVKNIDEHIVKFRTYGWGKT 168
            |.:.||...|.:..:|.|:|:...|                    ..|||.....|   |.:|:.
  Fly   113 LCIFRLQTEVEFKTHIRPMCITKSPKSLGLATTFEIINEKPKMWYFCKNIKGLFCK---YVFGEN 174

  Fly   169 ESRSSSRMLQKTSLFNLHRSECAKQYPHQQINRNHICAESANANTCNGDSGGPLTAIVTYDHVQM 233
            |.:..|:                                         .:|.|.|..::....:.
  Fly   175 EEKWQSK-----------------------------------------PTGSPWTETISNGPFKG 198

  Fly   234 VFQFGVTSFGHADCSKATVFTNVMTHLDWI 263
            :.::|:.|: ..:.:...|:.|||:|::||
  Fly   199 LVRYGILSY-RDNKTYDEVYINVMSHINWI 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30283NP_611587.2 Tryp_SPc 42..263 CDD:214473 52/249 (21%)
Tryp_SPc 43..266 CDD:238113 54/250 (22%)
CG43124NP_001247345.1 Tryp_SPc 41..>133 CDD:304450 30/97 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.