DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30283 and CG43125

DIOPT Version :9

Sequence 1:NP_611587.2 Gene:CG30283 / 37454 FlyBaseID:FBgn0260477 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001247344.1 Gene:CG43125 / 12798281 FlyBaseID:FBgn0262588 Length:258 Species:Drosophila melanogaster


Alignment Length:267 Identity:75/267 - (28%)
Similarity:115/267 - (43%) Gaps:50/267 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LAASSVVVLGSESGSFLEHPCGTVPISQFKILGGHNAPVASAPWMAMVMGE--GGFHCGGTLITN 75
            ||..::::....|..|||..|            |.::..:.|||:..:..|  ....|.||||..
  Fly     7 LAVFALLLFYQGSALFLEQNC------------GKSSVFSPAPWLVKIRPELSSNITCTGTLINE 59

  Fly    76 RFVLTSAHCI-ANGELKVRLGVLE------REAEAQKFAVDAMFVHTDYYFDQH--DLALLRLAK 131
            |||||:|.|| ...||.||||.::      .:.:.::..|....:|..|..:.|  ::|||||..
  Fly    60 RFVLTAASCIDYQTELIVRLGEIDGTLQNSSKLQYEEIYVARALIHRSYSSESHQYNIALLRLKT 124

  Fly   132 RVHYSDNISPICLLLDPLVKNIDE----HIVKFRTYGWGKTESRSSSRMLQ-KTSLFNLHRSECA 191
            .|.|..||.|||  :|..|..:.:    .|.|.:.....|.::....|.|. ..|||.:......
  Fly   125 SVVYKKNIQPIC--IDVNVGKVPKAPTFEIEKKKNEEPKKNKAGIMKRFLNWFLSLFGVREPRPD 187

  Fly   192 KQYPHQQINRNHICAESANANTCNGDSGGPLTAIVTYDHVQMVFQFGVTSFGHADCSKATVFTNV 256
            ...|.|.|                 ..|.|||..:  :...:..|:|:.|..::: ||..|:|:|
  Fly   188 VILPPQPI-----------------AVGWPLTKQI--NESALFHQYGILSHRNSE-SKKDVYTDV 232

  Fly   257 MTHLDWI 263
            |.:::||
  Fly   233 MAYVNWI 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30283NP_611587.2 Tryp_SPc 42..263 CDD:214473 66/236 (28%)
Tryp_SPc 43..266 CDD:238113 68/237 (29%)
CG43125NP_001247344.1 Tryp_SPc 37..>137 CDD:304450 38/101 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.