DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30283 and PIK3IP1

DIOPT Version :9

Sequence 1:NP_611587.2 Gene:CG30283 / 37454 FlyBaseID:FBgn0260477 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_443112.2 Gene:PIK3IP1 / 113791 HGNCID:24942 Length:263 Species:Homo sapiens


Alignment Length:85 Identity:19/85 - (22%)
Similarity:35/85 - (41%) Gaps:25/85 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 IFVVVVLLAASSVVVLG--SESGSFLEHP-----CG------TVPISQF----------KILGGH 47
            |.::|:::|..:.::||  .:.|..|:..     |.      |:|:|.|          |.:..|
Human   175 ITMMVIIIAIGAGIILGYSYKRGKDLKEQHDQKVCEREMQRITLPLSAFTNPTCEIVDEKTVVVH 239

  Fly    48 NA--PVASAPWMAMVMGEGG 65
            .:  ||........:||:.|
Human   240 TSQTPVDPQEGTTPLMGQAG 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30283NP_611587.2 Tryp_SPc 42..263 CDD:214473 7/26 (27%)
Tryp_SPc 43..266 CDD:238113 6/25 (24%)
PIK3IP1NP_443112.2 KR 22..102 CDD:238056
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 242..263 5/18 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143063
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.