DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30283 and CG42694

DIOPT Version :9

Sequence 1:NP_611587.2 Gene:CG30283 / 37454 FlyBaseID:FBgn0260477 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001188994.1 Gene:CG42694 / 10178792 FlyBaseID:FBgn0261584 Length:512 Species:Drosophila melanogaster


Alignment Length:262 Identity:78/262 - (29%)
Similarity:123/262 - (46%) Gaps:23/262 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 VVVLGSESGS-FLEHPCGTVPISQFKILGGHNAPVASAPWMAMVMGEGGFH--CGGTLITNRFVL 79
            :.||.|...| ||:..|| .|||...|.   ......|.|:|.:  ..|.|  |.|:||:.:|||
  Fly    11 LTVLQSHVNSKFLDDYCG-APISNQSIT---KLRQPQAGWLAHI--SNGTHVLCSGSLISKQFVL 69

  Fly    80 TSAHCI-ANGELKVRLGVLEREAEAQKFAVDAMFV--HTDYYFDQHDLALLRLAKRVHYSDNISP 141
            ::|.|| .:|:|.|:|||.........:.|..:.:  |:.... |.|:.||:|::.|.|:|.:.|
  Fly    70 SAAQCIDVHGKLFVQLGVSNATKSPHWYTVSNVVIPSHSGKRL-QRDIGLLKLSQSVDYNDFVYP 133

  Fly   142 ICLLLDPLVKNIDEHIVKFRTYGWGKTESRSSSRMLQKTSLFNLHRSECAKQYPHQQINRNHICA 206
            ||:.|:....::.:.:..|.|..|     .|.::..|...|..|.|..| |......:....|||
  Fly   134 ICIALNTNTLDMVKILQNFTTSAW-----LSKNKNPQTIVLSQLSRDRC-KLNLSGNVTPKEICA 192

  Fly   207 ESANA-NTCNGDSGGPLT-AIVTYDHVQMVFQFGVTSF--GHADCSKATVFTNVMTHLDWIVNTV 267
            .|... |:|..|||..|| .|:...::.....||:..:  |.:.||:..::.:|...:.||...|
  Fly   193 ASLQRNNSCFIDSGSALTQPIIQGSNIVREMLFGIRGYVNGRSWCSEPAIYIDVAECVGWIETVV 257

  Fly   268 RR 269
            ::
  Fly   258 QQ 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30283NP_611587.2 Tryp_SPc 42..263 CDD:214473 64/229 (28%)
Tryp_SPc 43..266 CDD:238113 66/231 (29%)
CG42694NP_001188994.1 Tryp_SPc 46..256 CDD:304450 64/218 (29%)
Tryp_SPc 46..253 CDD:214473 62/215 (29%)
Tryp_SPc 319..505 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 131 1.000 Inparanoid score I7012
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
44.050

Return to query results.
Submit another query.