DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30283 and plaua

DIOPT Version :9

Sequence 1:NP_611587.2 Gene:CG30283 / 37454 FlyBaseID:FBgn0260477 Length:273 Species:Drosophila melanogaster
Sequence 2:XP_017214157.1 Gene:plaua / 100008445 ZFINID:ZDB-GENE-090313-278 Length:421 Species:Danio rerio


Alignment Length:264 Identity:81/264 - (30%)
Similarity:131/264 - (49%) Gaps:41/264 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 EHPCGTVPIS-QFKILGGHNAPVASAPWMAMVMGEGGFHCGGTLITNRFVLTSAHCIANGE---- 89
            |..||...:. |.||:||..:.|.|.||||.:....||.|||||||..:|||:|||...|:    
Zfish   150 ELTCGERRLDRQTKIIGGLRSTVESQPWMAAIFKGDGFICGGTLITPCWVLTAAHCFPTGKRTQI 214

  Fly    90 --LKVRLG---VLERE-AEAQKFAVDAMFVHTDYYFD----QHDLALLRLAKRVHYSDNISPICL 144
              ..|.||   :.|.: .:.|||.|..:.:|.|:.:.    .||:|||::       ::.:..|.
Zfish   215 NRYSVVLGKNAINETDPVKEQKFTVSRLVIHEDFDYSTENYTHDIALLKI-------EDCNGQCA 272

  Fly   145 LLDPLVKNI----DEHIVKFRTY----GWGKTESRS--SSRMLQKTSLFNLHRSECAKQYPHQ-Q 198
            :....|:..    .:.::....|    |:|:.:..:  .||.|::|.:..:.:..|.:.|.:: :
Zfish   273 VKTKTVRTACLPPFQQMLPVGFYCEIAGYGRYQKGTFKFSRYLKQTEVKLISQKVCQRTYYNKDE 337

  Fly   199 INRNHICAESANANT--CNGDSGGPLTAIVTYDHVQMVFQFGVTSFGH--ADCSKATVFTNVMTH 259
            :|.|.:||...:..|  |.|||||||...|.    .::|.||:.|:|.  |:.::..|:|.|..:
Zfish   338 VNENMLCANGRDWKTDACQGDSGGPLVCEVN----NIMFLFGIISWGKECAEKNQPGVYTQVSNY 398

  Fly   260 LDWI 263
            ..||
Zfish   399 NQWI 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30283NP_611587.2 Tryp_SPc 42..263 CDD:214473 75/249 (30%)
Tryp_SPc 43..266 CDD:238113 76/250 (30%)
plauaXP_017214157.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170575884
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.