DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10494 and GT2

DIOPT Version :10

Sequence 1:NP_726079.1 Gene:CG10494 / 37453 FlyBaseID:FBgn0034634 Length:523 Species:Drosophila melanogaster
Sequence 2:NP_177815.1 Gene:GT2 / 844024 AraportID:AT1G76890 Length:575 Species:Arabidopsis thaliana


Alignment Length:231 Identity:55/231 - (23%)
Similarity:87/231 - (37%) Gaps:87/231 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 EDEH----ETEQKYAHLMN----LGN--ASHSVSENSSGKASRCKWTSAKVETFLEIIHQL---- 62
            :.:|    |:::..|.|::    :||  .:||||.:||      :|...:||..:.|...|    
plant   359 QSDHSITFESKEPRAVLLDTTIKMGNYDNNHSVSPSSS------RWPKTEVEALIRIRKNLEANY 417

  Fly    63 -----------KLQAALRRPRSNA-------------KVFRMV-----SREMARRNCPKSPKHLR 98
                       ::.|.:||...|.             |.|:.|     .|.:..:.||       
plant   418 QENGTKGPLWEEISAGMRRLGYNRSAKRCKEKWENINKYFKKVKESNKKRPLDSKTCP------- 475

  Fly    99 VKFHQMRRQY-ARARNGGEPF---------------EHFEAVHELMQGEDVSDL-DEEALESDSD 146
             .|||:...| .|.::|..|.               :..:...|..|.|.|.|. |||..||:.|
plant   476 -YFHQLEALYNERNKSGAMPLPLPLMVTPQRQLLLSQETQTEFETDQREKVGDKEDEEEGESEED 539

  Fly   147 MEADEDQSGMISETEGDD-------ALDASGSSVNI 175
             |.||::.|     |||:       .|:.:.|.::|
plant   540 -EYDEEEEG-----EGDNETSEFEIVLNKTSSPMDI 569

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10494NP_726079.1 Myb_DNA-bind_4 44..123 CDD:463994 22/127 (17%)
Myb_DNA-bind_4 178..257 CDD:463994
Myb_DNA-bind_4 304..391 CDD:463994
GT2NP_177815.1 GT1 40..105 CDD:213402
GT1 396..461 CDD:213402 12/70 (17%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.