DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10494 and UTF1

DIOPT Version :10

Sequence 1:NP_726079.1 Gene:CG10494 / 37453 FlyBaseID:FBgn0034634 Length:523 Species:Drosophila melanogaster
Sequence 2:NP_003568.2 Gene:UTF1 / 8433 HGNCID:12634 Length:341 Species:Homo sapiens


Alignment Length:180 Identity:48/180 - (26%)
Similarity:71/180 - (39%) Gaps:30/180 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   306 WTDEEVDSFLLIIRDNGFFRALDGSRKRNFQTLVHISNILAKQDIKRTPHQLRNKLRLLCKRHRE 370
            |:..|.:..|..:.....:|||...|::...|...:|..||:|.::|||.|.|.:.:.|..:.||
Human    63 WSARETELLLGTLLQPAVWRALLLDRRQALPTYRRVSAALAQQQVRRTPAQCRRRYKFLKDKFRE 127

  Fly   371 A-------------KEHGL--DNVRILPRHFELFDELIQAPRENRESAISRLIRISKPSFLKP-P 419
            |             |..||  ||.|..||.        ::|...|.....|.:    |:...| |
Human   128 AHGQPPGPFDEQIRKLMGLLGDNGRKRPRR--------RSPGSGRPQRARRPV----PNAHAPAP 180

  Fly   420 GKP-SVPLESDSDNSSSTCDLLRAAADSEDYVDAIEMEAEPTPIEALTAI 468
            .:| :.||.:..|..:.....||.:.......||......| |..|.||:
Human   181 SEPDATPLPTARDRDADPTWTLRFSPSPPKSADASPAPGSP-PAPAPTAL 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10494NP_726079.1 Myb_DNA-bind_4 44..123 CDD:463994
Myb_DNA-bind_4 178..257 CDD:463994
Myb_DNA-bind_4 304..391 CDD:463994 29/99 (29%)
UTF1NP_003568.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..62
Myb_DNA-bind_4 <94..134 CDD:463994 14/39 (36%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 146..273 25/97 (26%)
Leucine-zipper 279..310
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.