DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10494 and AT3G58630

DIOPT Version :10

Sequence 1:NP_726079.1 Gene:CG10494 / 37453 FlyBaseID:FBgn0034634 Length:523 Species:Drosophila melanogaster
Sequence 2:NP_191422.2 Gene:AT3G58630 / 825032 AraportID:AT3G58630 Length:321 Species:Arabidopsis thaliana


Alignment Length:243 Identity:49/243 - (20%)
Similarity:96/243 - (39%) Gaps:44/243 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   306 WTDEEVDSFLLIIRDNGFFRALDGSRKRNFQTLVHISNILAKQDIKRTPHQLRNKLRLLCKRHRE 370
            |.:..||.....:|...:....:....|::.|..::|  .||....||..|.:|::..|.|:::.
plant    38 WGNRYVDLSRGNLRQKHWQEVANAVNDRHYNTGRNVS--AAKSQPYRTDVQCKNRIDTLKKKYKV 100

  Fly   371 AKEHGLDN---VRILP-RHFELFDELIQA--PRENRESAISRL--IRISKPSFLKP--------- 418
            .|....::   ..|.| ..|...|:|::.  |..:...:...:  .|:|.|..:.|         
plant   101 EKARVSESNPGAYISPWPFFSALDDLLRESFPTSSNPDSTDNIPHQRLSLPMSINPVPVAPRSAI 165

  Fly   419 PGKPS-----VPLESDSDNSSSTCDLLRAAADSEDYVDAIEMEAEPTPIEALTAIIEGQKQLLAQ 478
            |.:|:     :|...|        |||....:...:..|....|.|    |.....||.:...:.
plant   166 PRRPATSPAIIPHAGD--------DLLGFRGNLNAFAAAAAAAACP----ASEDDSEGSRSRSSG 218

  Fly   479 IKTTNESFLRQQREQQHQFLEQVSELMHR-----DREETLRRISEMLQ 521
            ...:|:.  |:::.::.|..::|::.:.|     :|.|..:| .||::
plant   219 RSGSNKK--RERKIEKKQGYKEVADAIERLGQIYERVEEKKR-KEMVE 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10494NP_726079.1 Myb_DNA-bind_4 44..123 CDD:463994
Myb_DNA-bind_4 178..257 CDD:463994
Myb_DNA-bind_4 304..391 CDD:463994 19/88 (22%)
AT3G58630NP_191422.2 Myb_DNA-bind_4 23..122 CDD:463994 19/85 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.