DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10494 and AT3G25990

DIOPT Version :10

Sequence 1:NP_726079.1 Gene:CG10494 / 37453 FlyBaseID:FBgn0034634 Length:523 Species:Drosophila melanogaster
Sequence 2:NP_189228.1 Gene:AT3G25990 / 822196 AraportID:AT3G25990 Length:372 Species:Arabidopsis thaliana


Alignment Length:204 Identity:37/204 - (18%)
Similarity:80/204 - (39%) Gaps:36/204 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   268 EAAADAEAEAHLSSASDSDFNDSDEEEGDASQRSGAHFWTDEEVDSFLLIIR--DNGFFRALDGS 330
            :..::.:.:.|.....:|  :..::.|...:.:..|..|..:|..:.:.:.|  ||.|     .:
plant    19 DVTSNGDLQPHQIILGES--SGGEDHEIIKAPKKRAETWAQDETRTLISLRREMDNLF-----NT 76

  Fly   331 RKRNFQTLVHISNILAKQDIKRTPHQLRNKLRLLCKRHREAKEH-------GLDNVRILPRHFEL 388
            .|.|......||..:.::...|:|....:|.|.:.|..::||:|       |...:.......::
plant    77 SKSNKHLWEQISKKMREKGFDRSPSMCTDKWRNILKEFKKAKQHEDKATSGGSTKMSYYNEIEDI 141

  Fly   389 FDE------LIQAPRENRESA--ISRLIRISKPSF---------LKPPGKPSVPLESDSDNSSST 436
            |.|      ..::|.....|:  :...::.:...|         ::..|:|::.||::.|:....
plant   142 FRERKKKVAFYKSPATTTPSSAKVDSFMQFTDKGFEDTGISFTSVEANGRPTLNLETELDHDGLP 206

  Fly   437 CDLLRAAAD 445
               |..|||
plant   207 ---LPIAAD 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10494NP_726079.1 Myb_DNA-bind_4 44..123 CDD:463994
Myb_DNA-bind_4 178..257 CDD:463994
Myb_DNA-bind_4 304..391 CDD:463994 20/95 (21%)
AT3G25990NP_189228.1 GT1 53..118 CDD:213402 15/69 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.